SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018528 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018528
Domain Number 1 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-24
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 4 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.69e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 38-98
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 6 Region: 447-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 180-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.11e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018528   Gene: ENSMODG00000024004   Transcript: ENSMODT00000018861
Sequence length 502
Comment pep:novel chromosome:BROADO5:8:281557741:281572591:-1 gene:ENSMODG00000024004 transcript:ENSMODT00000018861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTEPLIFGPGSLSAEPASSFPREPQVPGMVFERDRLPGQDVVTFKDVAVDFTQEEWHLL
SPPQKELYKEVMLENAWNLLSVGFPAPPEDMISYLEQREAPWMLGQEGLRSCCPGRIECI
DNENKSKKIESELSSTVDRACPVTRFGLSYQDFRSKMDLQRFLSDGPNNFAFRQFCVAPQ
NSSHIEHQRRHTEDKSSERNQCGKIFMYSSSFALHQQVHTGEKPYECKQCGKAFKERSRL
AVHQRTHTGERPYECKQCGKMFSQSHNLITHQRIHTGERPYECKQCGKTFSRSYSLGLHQ
RTHTGEKPYECKQCGKTFRERSHLVAHQRIHTGEKPYECKQCGKTFRERSHLAVHQRTHT
DEKPYECKQCGKTFRERSRLGVHQRIHTGEKPYECKQCGKTFSKSPNLITHQKIHTGERP
YGCKQCGKLFKERSHLAVHQRTHTGEKPYECKQCGKTFSQSPNLITHQRIHTGERPYECK
QCGKTFSRSYSLVIHQRIHTFE
Download sequence
Identical sequences F7DLN2
ENSMODP00000018528 ENSMODP00000018528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]