SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018547 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018547
Domain Number 1 Region: 270-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000415
Family HkH motif-containing C2H2 finger 0.052
Further Details:      
 
Domain Number 2 Region: 215-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000935
Family HkH motif-containing C2H2 finger 0.065
Further Details:      
 
Domain Number 3 Region: 69-143
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000429
Family HkH motif-containing C2H2 finger 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018547   Gene: ENSMODG00000014827   Transcript: ENSMODT00000018880
Sequence length 426
Comment pep:known_by_projection chromosome:BROADO5:8:281617790:282013050:-1 gene:ENSMODG00000014827 transcript:ENSMODT00000018880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNIMYFGGTCQSPALPALVRPPAPPLQPSLDIKPFLPFPLDTAAAVNLFPNFNAGFFRT
LGAHQQNIMDPIQKAVINHTFGVPLPHRRKQIISCNICQLRFNSDNLPKNTNEYQLTLRE
SQAAAHYKGTKHAKKLKALEAMKNKQKSVPAKDSAKTTFTSITTNAINTSSDKTDSTAGT
PAISTTTTVEIRKSSVVTTEITSKVEKTPPTTTASGTNSTCPSTETEEEKAKRLLYCSLC
KVAVNSASQLEAHNSGTKHKTMLEARNGSGTIKAFPRAGVKGKGPINKGNTGLQNKTFHC
EICDVHVNSETQLKQHISSRRHKDRAAGKPPKPKYSPYNKLQKGTHPLGVKLVFSKEPSK
PLAPRILPNPLAAAAAAAAVAVNSPFSLRTAPAATLFQPSALPPALLRPAPGPIRTTHTP
VLFAPY
Download sequence
Identical sequences F7D1N5
ENSMODP00000018547 ENSMODP00000018547 XP_007505224.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]