SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018582 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018582
Domain Number 1 Region: 11-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.36e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 320-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.07e-21
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 179-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 235-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.85e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 142-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000467
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 285-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000032
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018582
Domain Number - Region: 368-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0155
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018582   Gene: ENSMODG00000014852   Transcript: ENSMODT00000018915
Sequence length 392
Comment pep:novel chromosome:BROADO5:7:166204025:166205285:-1 gene:ENSMODG00000014852 transcript:ENSMODT00000018915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVLLPPRAHQELVAFKDMTVDFTPEEWGHLHPSQKELYRDMMLENYQNLVWMGLAVSK
PDMIYQLEQVEAPWVPEREVPAISVQILRLDLKPSWPLQSWTFLWKYHSRKKSSGMTLVS
PNCEKPLNMIPLESQQNNEEKLNECNECGKSFHQITQLPQPQNIHIGERPYVCKDCGKAF
CRCPALTQHWKIHIGEKPYICTECGKAFHQRAGLTQHQKTHTREKPYMCKECGKFYQSTA
LTLHQRVHTGEKPYECIECGKAFHQRTGLNQHQKIHTGEKKPHVFCKVCGKAFHQSTALT
QHQRIYTGERPYECTKCGKSFNCNSYLISHYRIHIDHRPYECKECGEAFRWSTQLTRHQR
IHTDKKPYECNECGKGSGLTGHQKMHTQEKSC
Download sequence
Identical sequences F7BYP7
ENSMODP00000018582 13616.ENSMODP00000018582 ENSMODP00000018582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]