SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018659 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000018659
Domain Number - Region: 36-45,161-166
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000575
Family Formin homology 2 domain (FH2 domain) 0.038
Further Details:      
 
Domain Number - Region: 110-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0011
Family Classic zinc finger, C2H2 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018659   Gene: ENSMODG00000014924   Transcript: ENSMODT00000018996
Sequence length 469
Comment pep:known_by_projection chromosome:BROADO5:7:169496513:169543609:-1 gene:ENSMODG00000014924 transcript:ENSMODT00000018996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFGWYPPPGPPPVLTLPGFETDRSADWTSWVLPPPPPPPPPLPPSSENSWDFQPARDW
SWAPAQGYDGFDPQQGHWYQQPGRNYHFPKKNHDRSNRNFKNQQSGKQKQKKNKEPVYTH
YCDTCDRGFKNQEKYDEHISQHRTCSVDGCSFSAHEKIVQIHWKNMHGPGAKRIKLDTPE
EIEKWREERRKNFPTRANIEKKKMLQEEKEQRGEVLTTKQFGKMQRKWKQPHSDVAGKQP
YGKHRKWQKWQKWHGGRKMPEMHENMTIGPPPDHSQAPEPLVAQTEVYQKDVDPLGMLAD
SEAESDKEEKPENVVIPKEVTSALGLLMTNYGNMSGSESEPEETPIKTEEDPPGENQVIL
SDVPQNQSEDIKKQERNSPVAKTKSLRKNWMRKNCRYKRGLYRKKPVSEPQKRRPHLLEM
LLAQDIRHERNVILQCVRYIIQNDFFGLNSKAEPLEKTENRQVSEVSES
Download sequence
Identical sequences F7FVR1
ENSMODP00000018659 ENSMODP00000018659 XP_001369929.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]