SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018793 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000018793
Domain Number - Region: 2-12
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00214
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018793   Gene: ENSMODG00000015032   Transcript: ENSMODT00000019132
Sequence length 454
Comment pep:known chromosome:BROADO5:1:294051359:294345287:-1 gene:ENSMODG00000015032 transcript:ENSMODT00000019132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPFPPPRPPPPPPNHGELPEHSLGQRKLFIMRKSLLDELFEVDHIRTIYHMFIAVLILFV
LSTVVVDYIDEGRLVLEFSLLSYAFGKLPHVLLIWLYMFLATLIISYVLLERWAKGYTES
SRPFFRSFCYGMLFMFFQILVLGCGSTYTVLAYTLPPASRFIVILEQVRFIMKAHSFIRE
NVPRVLAAAKEKSRTVPVPQVSQYLYFLFAPTLIYRDNYPRNSTIRWSYVATRFAQVFGC
LFYTYYIFERLCVPLFRNIKQEPFSLRVLVLCIFNSILPGVLMLFLSFFVILHCWFNAFA
EMLRFGDRMFYRDWWNSTSYANYYRTWNVVVHDWLYYYAYKDFLWFFSRRFKTAAMMSVF
AVSAIVHEYALALCFSFFYPVLFVLFMFFGMIFNFIANDNRKRPIWNIMMWTSLFLGHGI
LVCLYSHEWYARQQCPLKNSTFLDYIRPRSWTCH
Download sequence
Identical sequences F7BXC0
ENSMODP00000018793 13616.ENSMODP00000018793 ENSMODP00000018793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]