SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018836 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000018836
Domain Number - Region: 728-790
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0288
Family Formin homology 2 domain (FH2 domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018836   Gene: ENSMODG00000015065   Transcript: ENSMODT00000019175
Sequence length 1161
Comment pep:known_by_projection chromosome:BROADO5:8:188639847:188672075:1 gene:ENSMODG00000015065 transcript:ENSMODT00000019175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMEAGNGSGAMSWKNQCSGFPVTPAGSCEGFEGCERKKGQRWGSLEHWGQTMDGEVLLP
ALYEEEEEEEEEEKEPEPEPEQEQKDSNVKPLQVSKLRGLSLTETELEELRAQVLQLVAE
LEETRELAGQHEDDSLELQGLLEDERLASAQQAETFTKQIQKLQGELRSLREEISILEQE
KETELKDIEQELQMAQDEIHTLRQAAEDAAVEHEGDIANLQEDLCRMRTELSGMERIHEE
YQMEISSLRSEIKMKTDPSSSGSTVFSDVSMLQEELQQLRDRCSLLTEEYQALQMSNSSL
CEQLEEMESQRKMRVAERWLESQTKDTSTTESQTSDMSCVDEDEESESLRQQLQCAEDQI
QEMESKCNVLYTELQDLQKVHHASEGEQKRLQKDLKFFQEELQRLKNCQDAIVKKQTDDL
VKKLSDLQKKYQESQKEQASLAQERTQLKEELLKSKEEQCKLLAMRRALAESNKNEKELK
AKLEDLQSRYLESQDQNCQLLSIQEKLQEDLEEVERLKVMEASNNEIMEKNMELEARVQD
LEVLHQASQEEQARQLQVQDELQEALTAYQQDVEMLRKAQQKLQPQCQTQLKFSGLVHRL
KELHNMYNCSQKEVAHLQCEQRKLLKNQRRMQEEHCQLQQEMRKLTFPVPKPALLKKSQE
LLAKLNQLEELQISYQNRQEEQKKLVESQDHLLKEQAQVQEEFRHLKGCQITLAPSCVKL
SNGVKKDKSCGDLYNKIQELHVLYQATNLEQEQLQEEQGKLLEEHKKLQNDLQLCQKEMR
VLHSLTPKMSMESTKSYRRSYNSSSSSSSNCGSYDDDDISVCSESFEVGLPAPGKTGVRP
SPGSHGVPLLHQVLETVASVMNRLQEVKSVYVVCQDDQGQLQLDMMQLLKKLGHLQEDLE
LCQEEIKENQDVKKGPLCPNLQFKELQTKLRELQLQYQSSIDEQCRLLAVQEQLECQLQC
CQEELCQLKAEKPCGPKDSREWCRSDVNGVHLEKITEPTDELATIRVGLGESPELEVVLY
YRASPTELERQAEELMFPEMLEEEEPEAKGDPEAAAGPEVAAGQKVASGRKGEAGSKGAA
RSKRGSGPGVELEIEEESETEVEEDEDEELSKPDCKDGTPIKISDSKKPPPDPDPPLFSL
PRVGLVVILALLWCWWAETSS
Download sequence
Identical sequences F7FHJ7
ENSMODP00000018836 ENSMODP00000018836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]