SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019017 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019017
Domain Number 1 Region: 509-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 117-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 621-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 62-118
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 230-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 8 Region: 678-734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.7e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 174-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 288-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 11 Region: 565-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 12 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-20
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 13 Region: 2-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-18
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000019017
Domain Number - Region: 726-751
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0136
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019017   Gene: ENSMODG00000015223   Transcript: ENSMODT00000019360
Sequence length 752
Comment pep:novel chromosome:BROADO5:3:526144328:526152765:-1 gene:ENSMODG00000015223 transcript:ENSMODT00000019360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSLSFKDVAVDFTQEEWCLLDHSQKELYLEVMLDNVQNLLSVGKGLCKKELIIFLLKRGK
PFSQNSDLAAHQIIHSGEKLYECKQCGKTFKRRDSLVVHHRIHSGEKPYECKHCGKAFTQ
CGTLAAHQRIHTGEKPYKCKQCGKAFSERGSLTRHQKTHTGEKPYECKHCGKVFKGRGLL
TRHQLIHSGEKPYKCKQCVKAFSERGSLTRHQKIHTGEKPYECKHCGKAFKGRGFLTRHQ
LIHSGEKPYECKQCGKAFTQRSHLSRHQSIHIGEKPYECKQCGKDLKYSCFLAVHHLIHT
GEKPYRCKQCGKAFNWKISLEAHQRNHTGEKPYECKQCGKAFNWKVSFAAHQRIHTGEKP
YECKHCGKAFTLRGSLVAHQRIHTGEKPYACKHCGKAFRHKDNLNTHQRIHTGEKPYECK
QCGKAFTQSGNLATHQRIHTTEKLYECKQCGKAFRRKDSFAAHHKSHTEENPYECKQCGK
AFIKRSSLTKHQRIHTDWKPYECKYCGKAFREKQELAAHQRIHTGEKPYECKQCGKAFTQ
RGNLAAHQRIHTTEKPYECKQCGKAFRQKDNLATHHKLHTGEKSYECKQCGKAFTKRSYL
SKHQKIHTAEKPHECKHCGKAFKQKHYLAAHQRIHTGEKPYECKQCGKAFSERGSLTKHQ
KIHTGEKRYECKQCGKDFLCRSTLAAHQRTHTGEKPYECKYCGKTFTYSNSLIAHHRIHT
GVKLHECKQCGKAFLRRYTLTSHQLIHTGEKP
Download sequence
Identical sequences F6V3T2
13616.ENSMODP00000019017 ENSMODP00000019017 ENSMODP00000019017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]