SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019031 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019031
Domain Number 1 Region: 485-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000803
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 2 Region: 67-94
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000203
Family C2HC finger 0.064
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000019031
Domain Number - Region: 221-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00013
Family Plant C2H2 finger (QALGGH zinc finger) 0.076
Further Details:      
 
Domain Number - Region: 617-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000169
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 289-311,355-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000478
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019031   Gene: ENSMODG00000015235   Transcript: ENSMODT00000019374
Sequence length 666
Comment pep:known_by_projection chromosome:BROADO5:8:186992597:187019453:-1 gene:ENSMODG00000015235 transcript:ENSMODT00000019374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLRDKCCQTDHHHHGCCEPVYILEPGDPPLLQQPLQTSKSGIQQIIECFRSGTKQLKHI
LLRDVDTIFECKLCRSLFRGLPNLITHKKFYCPPSLQMDDNLPDVNDKQSQAINDLLEAI
YPSVDKREYIIRLEPIETNQNAVFQYISRTNNPAEVTESSNSPDQTQVQMQEPNTEQSKT
TPVPDAEVEIVESPPTETVANEATPASDEQPQESHTDLETSDNSDFGHQLICCLCRKEFN
SRRGVRRHIRKVHKKKMEELKKYIETRKNPNQSSTKGRNKNVLVTLSRSCPVCYKSFATK
ANVRRHFDEVHRGLRRDSITPDIATKPGQPLFLDTVSPKKSFKTRKQKSSSKAEYNLTAC
KCLLCKRKYSSQIMLKRHMQIVHKITLSGTNSKREKGPNNTANSTEIKVKVEPSDSVESS
PPSITHSPQNELKGTNHSNEKKNTPAAQKNKVKQDLDSPKSTSPSAAGGQQKTRKPKLSA
GFDFKQLYCKLCKRQFTSKQNLTKHIELHTDGNNIYVKFYKCPLCTYETRRKRDVIRHIT
VVHKKSSRYLGKITASLEIRAIKKPIDFVLNKVAKRGPPRDEAKQNDSKHDGTSNSPNKK
YEVADVGIEVKVTKNFSLHRCNKCGKAFAKKTYLEHHKKTHKANASNSPEGNKTKGRSTR
SKALVW
Download sequence
Identical sequences F6UKB3
ENSMODP00000019031 ENSMODP00000019031 XP_007504314.1.35504 XP_007504315.1.35504 XP_007504316.1.35504 XP_007504317.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]