SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019283 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019283
Domain Number 1 Region: 153-214
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 385-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 441-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 803-859
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 690-747
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 844-896
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-20
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 747-803
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.51e-20
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 349-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000036
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 653-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000373
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019283   Gene: ENSMODG00000015447   Transcript: ENSMODT00000019631
Sequence length 965
Comment pep:known_by_projection chromosome:BROADO5:6:163307477:163343326:-1 gene:ENSMODG00000015447 transcript:ENSMODT00000019631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALHTSPESPTSQLERMEVRPECEADHEGSSDLVEESLEDIEGSPELMEDSPEEVEGSP
EEEDDSSELIDGSPEAIDGLPEPGSPEPELQEPLNDDSKMESPVLQEKVHELGREIKNSV
LSSSASSVSWVPAILKKEILDDDEPVTDFLTTESQGLVTFEDVAVYFSLEEWGRLNESQK
DLYREVMQENYGILVSLGYPIPKPDVISRMERGEELWVPESPGPEEGDILTGVYTALSLW
TRDIARSTSNEREETCPFIVLVSSKESEPPGVWSAAYGVGDVPGTWGPDDSVQAPPTDLW
GGDPTNIGMVPEGQEMKPILHGGEAGAPLLPPWAFSAVVEAAGGRPETTCDVCGKVFPHR
SGLAKHRRYHAAVKPFGCEECGKGFVYRSHLAIHQRTHTGEKPFPCPDCGKRFVYKSHLV
THRRIHTGERPYRCSFCGAGFGRRSYLVTHQRTHTGERPYPCPQCGRSFSQSSALARHQA
VHTAEKPHCCPDCGRAFRLRADFQRHRRGGKCSDLREEVRREESEGAELGGEGLEPVNET
PVIERTYPELGNGFGEGEGPSHPLDFHFPLPPKSWLHGENLPMLALQDFGERVAHELVDA
PPLPGHLGSQISLIDGTAMPCDPCASGLLPFGPSVGSLLADPQPSSMLEEETPWICSDCG
KTFGRRAALAKHQRYHAGDRPHRCADCGKSFVYGSHLARHRRTHTGERPFPCPECGARFA
RGSHLAAHVRGHTGEKPFVCGVCGAGFSRRAHLTAHGRAHTGERPYACGECGRRFGQSAA
LTRHQWAHAEEKPHRCPDCGKGFGHSSDFKRHRRTHTGEKPFRCADCGRGFAQRSNLAKH
RRGHTGERPFPCPECGKRFSQRSVLVTHQRTHTGERPYACAACGRRFSQSSHLLTHMKTH
RGTTTGPAAKAEAPGQKQASRPSGEKEDSSSSKTVAEFGGSSSFVSEEPSAVFPGPSCSY
EETLM
Download sequence
Identical sequences F6S429
ENSMODP00000019283 ENSMODP00000019283 13616.ENSMODP00000019283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]