SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019287 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019287
Domain Number 1 Region: 41-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.97e-35
Family SCAN domain 0.0000652
Further Details:      
 
Domain Number 2 Region: 841-897
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 785-841
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 882-934
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-16
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 227-287
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000536
Family KRAB domain (Kruppel-associated box) 0.0061
Further Details:      
 
Domain Number 6 Region: 736-785
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000161
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019287   Gene: ENSMODG00000015452   Transcript: ENSMODT00000019635
Sequence length 966
Comment pep:known_by_projection chromosome:BROADO5:6:163267476:163289719:1 gene:ENSMODG00000015452 transcript:ENSMODT00000019635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTTTLCPPVKAPLELKGSLMMKMEKDTSWASESPLQGEDSDSETLRKSFRQFCYEDVSG
PHEAFNRLWELCRQWLKPEVRSKEQILELLVLEQFLAILPKEIQAWAWKQCPESGEEAVA
LIADLEGEPGRLRQQVTNHVHLEKTVALGAAWEVPRFQMDQVKGQPKMVTQEKSGNLRLG
LQRQLNHKGDPQCLQKNALPPPWIADLPEKRNTRDQEMMAIPFLTTGSQEPVICLGMSRN
LSHKKWGHLNPAHKNFCRGIMKENYRNMVSLGIPISTSKKVSPLAQRKKPWVLGLQGSNK
KYILRGSHSEGKQGPIQALEKRNGKTWRDQQPWGGLEDEKIAGVHWSYDETKTFLAILRE
SRFYETLRACPRNSQVYGAVAEWLRECGFLRTPEQCRTKFKSLQKSYRKVRNGHMQEPCA
FYEEMDALLNPGPHVTITDIPNETNSPLRQGNITPKAEEEDSWELEEAAEESDGEEMSLE
FTQKPKITRAPALFQNLSGVHWGYEETKTFLNILSESRFYEALQACHRKSKVYGAVAEQL
QEYGFLRTPEQCRTKFKSLQKSYRKVRNGSMLESCAFYEELDALMNTQASATSTDILEEV
KLLRQGENGIEIEPQEPGGWEHEMSLQAAVVEDSDNQRISTKELIEDHESQSPQTLGQSL
SGFEISKRNKKDPTQIYEKVELHSTLPGKSKGGILHNTDPGKDYKKGYTSERQWRNYLPG
NRKGKFITQHRDLVKVIGHRRPFMGRRPYRFFKYGRSFLQSSHLMCQAAHQKENSYKCNV
CGKCFGRSRSLIRHQRIHTGEKPFKCLECGKSFNDSSNFGAHQRIHTGEKPYKCSVCEKC
FSQSSSLIIHQRTHTGEKPYQCSECGKSFTNSSHFSAHRRIHTGENPYKCVNCEKSFSNC
TQFREHQRTHTGEEPYDCSHCGKSFSKSSALTKHRGVHMREKLPSQLKSDYTPENLGRAD
EFGKFF
Download sequence
Identical sequences F6S3Z6
ENSMODP00000019287 ENSMODP00000019287 XP_001370497.3.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]