SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019294 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019294
Domain Number 1 Region: 300-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 356-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-17
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 261-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019294   Gene: ENSMODG00000015458   Transcript: ENSMODT00000019642
Sequence length 471
Comment pep:known_by_projection chromosome:BROADO5:8:179965989:179969575:-1 gene:ENSMODG00000015458 transcript:ENSMODT00000019642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCSSHHPTTKILASPPTRESLPARGNMISASKPLAFSIERIMARTPEPKSMPVPHFLQG
SVPKGDPKHSLHLNSSIPCMIPFVPVTYDTSPKAGMTGSEPRKTSLDSSTSSPAAASFSC
SDLLNCALSLKGDFARDALPLQQYKLVRPRVVNHSSFHAMGALCYFNRGDSPCHPSASVN
IHPVASYFLSSPLHPQPKTYLAERNKLVVPTVEKYPSGVAFKDLSQAQLQHYMKESAQIL
SEKIAFKTSEFSRGSPNSKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGF
RQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKG
NYKNHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKK
HVRKLHDSALGLPRAPAEAGADPSPPMQPQPSIPPPPPPGSLQPPLHQGHQ
Download sequence
Identical sequences F6S3M2
ENSMODP00000019294 ENSMODP00000019294 XP_003342064.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]