SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019347 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000019347
Domain Number - Region: 5-56
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0209
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019347   Gene: ENSMODG00000015501   Transcript: ENSMODT00000019695
Sequence length 300
Comment pep:known_by_projection chromosome:BROADO5:7:174457296:174468339:1 gene:ENSMODG00000015501 transcript:ENSMODT00000019695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPSAPPPYEDRNPLYPPPPPGGYPGGYPAYPQPGFGHPAGYPQPMPPIHPMPMNYGEG
DVYGGDEPAMSDSLGGEWRDKKVRHRSFRRVYTIISIQLLITVAIVAIFTFAEPVKTFVK
RNVAVYYASYAVFLATYLTLVCCQGPRRRFPWNLILLTIFTFAMSFMTGCIASMYNSRSV
ILAMLITAVVSIAVTIFCFQTKVDFTSCAGLFCVLGIVLTVTGIITAIVLAFKYVPWLHM
LYAALGAIAFTLFLAYDTQLVLGNRKHTISPEEYITGALQIYTDIIYIFTFVLQLLGDHN
Download sequence
Identical sequences F6WEN6
13616.ENSMODP00000019347 ENSMODP00000019347 ENSMODP00000019347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]