SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019450 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019450
Domain Number 1 Region: 995-1052
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 547-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 883-940
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.09e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.55e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 603-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.21e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 1051-1108
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.39e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 827-884
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 9 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 10 Region: 715-772
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 11 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 12 Region: 771-828
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.55e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 13 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 14 Region: 939-996
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.36e-22
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 15 Region: 659-716
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 16 Region: 82-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-20
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 17 Region: 1093-1145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 18 Region: 144-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.71e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 19 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-18
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 20 Region: 495-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 21 Region: 397-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000533
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019450   Gene: ENSMODG00000023037   Transcript: ENSMODT00000019799
Sequence length 1150
Comment pep:novel chromosome:BROADO5:1:718257732:718314318:1 gene:ENSMODG00000023037 transcript:ENSMODT00000019799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITFKDVAVDFSQEEWCLLDHSQKELYVEVMMANVKNLLSVGLPVSRVDFLSCFQQGEAQC
LLEQKGPRSSCPGEVVIPNDFYLQKSTLHSYQKIHCGEKPYKCKHCGLAFTQRSNLARHQ
TVHSGEKPYKCKQCGKAFTERGSKPYECKQCGKAFKQRVSLATHHKIHSGEKPYECKQCG
RAFSVRSSLTQHQRVHSGEKPYECEQCGKTFRWCSLLSEHRRIHTGEKPYECKQCGKAFT
RWCTLAKHQRIHSGEKPYECKQCGKAFTRLCTLTDHQRIHTGEKPYECKQCGKAFTRRVG
LAAHQKIHSGEKPYECKQCGRAFAQRVTLANHQMIHSGEKPYECKKCGKAFSVSFSLARH
QIVHTGEKPYECKQCGKAFALKHSLAEHQKIHSGEKPYECKQCGKAFAVKSGLAIHQKFH
TGEKSYECKQCGKAFTLSGSLARHQTVHSGEKPYECKQCGKAFTWRASLAEHQRIHTGEK
PYECKQCGKAFIRRIGHLTAHQSIQTREKPYECKQCGNAFTERDSFARHQTVHSVEKPYE
CKQYGRSFSQKSELDSHQKIHCGEKPYECKQCGKAFTQRGGLAIHQRIHTGEKPYECKQC
GKAFTEKGSLVRHQTVHSGEKPYECKQCGKAFTLRFSLITHQRIHTGEKPYECKQCGKAF
TNRGSLARHQTVHTGEKPYECGQCGKTFTQKLGIAMHQMIHAGEKPYECKQCSKAFTRRS
YLTAHQRIHSGEKPYECEQCGKTFRWCGLLSEHQRIHTGEKPWECKQCGKTFIRWCTLAK
HQRIHSGKKPYECKQCGKTFSQRDHLAEHQRIHTGEKPFKCAQCGKAFTQRGSLAMHQTI
HSGEKPYECKQCGKAFTQRGHLVKHQTIHSGEKPYECKQCGKAFSLRSSLARHQTIHTGE
KPYECKQCGKAFALKHSLAEHQKIHSGEKPYECKQCGKTFAVKCSLAIHQRFHTGEKSFE
CKQCGKAFTLSGSLARHQTVHSGEKPYECKQCGKAFTLRGSLARHQIIHTGEKPYECNQC
GKAFTVRRSLVDHQRIHTGEKPYECKQCGKAFTQRRNLADHQRIHSGEKPYECKQCGKVF
RQRGGLAMHQKIHSGEKPYECKQCGKAFTQWGGLSKHQAIHSGEKPYECQQCGKAFTQKG
GLSKHQAIHS
Download sequence
Identical sequences F6ZUK3
13616.ENSMODP00000019450 ENSMODP00000019450 ENSMODP00000019450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]