SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019533 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019533
Domain Number 1 Region: 409-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.07e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 197-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000375
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 365-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000352
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 4 Region: 451-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000397
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 157-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000567
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019533   Gene: ENSMODG00000015649   Transcript: ENSMODT00000019882
Sequence length 547
Comment pep:known_by_projection chromosome:BROADO5:1:508690287:508698175:-1 gene:ENSMODG00000015649 transcript:ENSMODT00000019882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRKQSHPQPVTCLSVVDTEDPLEEGPGALVLESDLLLGQDLEFEEEEEEEEEEEEEEE
EGDGSSDQLMGFERDSEGDSLGARPGLPYGLSDDESGGGRALSAESEVEEPARGQGEAGG
ERPGPACQLCGGPACEGPCCGAGGPGGGPPLPPRLLYSCRLCAFVSHYSSHLKRHMQTHS
GEKPFRCGRCPYASAQLVNLTRHTRTHTGEKPYRCPHCPFACSSLGNLRRHQRTHTGPPG
PPCPTCGFRCCAPRPPRPPSPTEQEGAVPHRPEDAVLLPDLSLHVPPGGASFLPDCGQLR
GEGEGLRGTGPEPLPELLFPWACRGCGQELEEGEGEGSRLGAAMCGRCMRGEAGGGGSGG
PRGPGDKGFACSLCPFATHYPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHT
GEKPYKCPLCPYACGNLANLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKP
FRCGTCAYTTGHWDNYKRHQKVHGHGGAGGPASEGWAPTHSTSSALSPHGPTSLSTTSGR
GLHTDSP
Download sequence
Identical sequences F7F0U4
13616.ENSMODP00000019533 ENSMODP00000019533 ENSMODP00000019533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]