SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019572 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019572
Domain Number 1 Region: 112-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000121
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 153-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000867
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 443-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000142
Family Classic zinc finger, C2H2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019572   Gene: ENSMODG00000015683   Transcript: ENSMODT00000019921
Sequence length 500
Comment pep:known_by_projection chromosome:BROADO5:7:180922519:181121883:1 gene:ENSMODG00000015683 transcript:ENSMODT00000019921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METEAIDGYITCDNELSPEREHSNMAIDLTSSTPNGQHTSPSHMTSTNSVKLEMQSDEEP
DRKPLSREGDIRGHDEGSSLEEPIIESNDVADNRKIQELQGEGGIRLPNGERPFHCNQCG
ASFTQKGNLLRHIKLHSGEKPFKCPFCSYACRRRDALTGHLRTHSVGKPHKCNYCGRSYK
QRSSLEEHKERCHNYLQNVSMEASGQVMSHHVPPMEDCKEQEPVMDNNISLVPFERPAVI
EKLTGNMGKRKSSTPQKFVGEKLMRFGYPDIHFDMNLTYEKEAELMQSHMMDQAINNAIT
YLGAEALHPLMQHTPNTIAEVAPVISSAYSQVYHPNRIERPVSRETSDSHENNMDGPISL
IRPKSRPQEREASPSHSCLDSTDSESSHDDRQSYQGNPALNPKRKQSPTYMKEDVKALDA
TKASKGSLKDIYKVFNGEGEQIRAFKCEHCKVLFLDHVMYTIHMGCHGYRDPLECNICGY
RSQDRYEFSSHIVRGEHTFH
Download sequence
Identical sequences F7E1C9
13616.ENSMODP00000019572 ENSMODP00000019572 ENSMODP00000019572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]