SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019590 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019590
Domain Number 1 Region: 51-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 95-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 492-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 243-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-18
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 5 Region: 358-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 162-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 396-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-16
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 567-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000963
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 456-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000012
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 10 Region: 306-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000188
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 11 Region: 533-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000661
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019590   Gene: ENSMODG00000015697   Transcript: ENSMODT00000019939
Sequence length 620
Comment pep:novel chromosome:BROADO5:Un:56131708:56147161:1 gene:ENSMODG00000015697 transcript:ENSMODT00000019939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLAEYDLWDSNLGPYWECDGRFQRPQETHERNLRQITISHKNIPYKIRICFNDGSSRTKH
QRIHTGEKPYKCSDCGTSFIDSSSLAQHQRIHTAEKPYKCSECGAAFTHSSLSPHQRIHT
GEKPFKCNECGIAFRQNALLILHQRMHTGEKPYEWSGRGKAFGDSSSFTKHQSIHTGEKP
NKCNDCRKSFSDSSSFTRHQRIHTGEKLYKCTCGNSFSDSSSLPLLRGFGGKNPFRCKEC
GYTYRQNALLVLHLRVHTGEKPYECSRCGKAFSSSSSLMKHQRICIGPKSYKFIDCGKSF
NDSLSSQHQKIHTEEKPYQCNEECAEAFLHSKFLTQHQGMCTGGKHYKCKECGKVLSKFH
LLNHQRVDTGEKPYECNECGKGFNDGSSRTKHQRIHTGDKPYTCSDSGTSFIDCSSLAQH
QRIHTGEKPYKCSECGAAFTHSHPLLPTREFILEKKCNECGKAFRQNAFLILHQRMHTGE
KPYEWSGRGKAFGDSSSFTKHQSIHTGEKPNKCNDCRKSFSDSSSFTRHQRIHTGEKPYK
CTCGKSFSDSSSLSHHQRIHPGGKNPLIHTGEKPYECSRCSKAFSSSSSLMKHERIRIGP
KSYKFIDCGKSFNDSLSSQH
Download sequence
Identical sequences H9H6S1
ENSMODP00000000588 ENSMODP00000019590 13616.ENSMODP00000019590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]