SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019593 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019593
Domain Number 1 Region: 666-757
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 3.79e-40
Family Small-conductance potassium channel 0.00000275
Further Details:      
 
Domain Number 2 Region: 535-706
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000019593
Domain Number - Region: 201-268
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0152
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019593   Gene: ENSMODG00000015701   Transcript: ENSMODT00000019942
Sequence length 850
Comment pep:known_by_projection chromosome:BROADO5:3:55616504:55817938:1 gene:ENSMODG00000015701 transcript:ENSMODT00000019942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVVLVRPTNRTHLLDSTGAEMGPSSHQQQDSHLSTITHCAECTTVWSPCSFNSSDMETP
LQLQRGFFPEQQQQQQNQQQPKQLTQDKPCLSFQQHSKQHYYHHHHHQQQPQIHQWQPGS
SGSSSCLQCNSCASSSAQVAGGRVGDNLPLLLRTSSPGSAFGTRNSSPVSTSSCCCCSSR
RGSQLNVSELNPSSHASVSRKQQQQQQQQQQQQQQFAQYQYSSQYHQCSLQQAASPTSSL
RSSGGGSGHPHHHHHHHHHQQLQQGRRESNPFTEIAMSSCRYNGGVMRPLSNLSSSRRNL
HEMDSESQPLQPSGSGGCRSSPPTAAVPATAAAPSSSAPEIVVSKPEHNNSNNLGLLGSG
RLGGGGSGKITRPSSRCSKFSKKKTQNIGYKLGLRRALFEKRKRLSDYALIFGMFGIVVM
VIETELSWGAYDKASLYSLALKCLISLSTIILIGLIIVYHAREIQLFMVDNGADDWRIAM
TYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYTSSTTTADVDIILSIPMFLRLYLI
ARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTV
RACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALV
VAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVR
KHQRKFLQAIHQLRSVKMEQRKLNEQANTLVDLAKTQSLICDMVSDLNERSEDFEKRVVT
LENKLETLIGSIQALPVLISETVSQQQRKFMEAHMQSLNLEGSHSADRSRSLSRRRRSSS
TAPPTSSESS
Download sequence
Identical sequences F7E0I4
ENSMODP00000019593 ENSMODP00000019593 XP_001370092.3.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]