SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019947 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019947
Domain Number 1 Region: 232-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000124
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 265-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000525
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019947   Gene: ENSMODG00000015982   Transcript: ENSMODT00000020304
Sequence length 301
Comment pep:known_by_projection chromosome:BROADO5:7:188086933:188188780:1 gene:ENSMODG00000015982 transcript:ENSMODT00000020304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVLASYSIFQELQLVHDTGYFSALPSLEENWQQTCLELERYLQTEPRRISETFGEDLDC
FLHATPHPSIEESFRRLDPLLLPMEASPCEKSSAVDILLSRDKLLSETCLSLQPPSSSLD
SYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGG
VAAAAAVASAGAIKSGQSDSEQGGIGADASPENKKRVHRCQFNGCRKVYTKSSHLKAHQR
THTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKRH
I
Download sequence
Identical sequences F7EZL7
XP_001370370.1.35504 ENSMODP00000019947 ENSMODP00000019947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]