SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019955 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019955
Domain Number 1 Region: 928-1167
Classification Level Classification E-value
Superfamily ARM repeat 1.73e-74
Family MIF4G domain-like 0.000000000667
Further Details:      
 
Domain Number 2 Region: 1396-1586
Classification Level Classification E-value
Superfamily ARM repeat 2.3e-58
Family MIF4G domain-like 0.000000343
Further Details:      
 
Domain Number 3 Region: 1603-1731
Classification Level Classification E-value
Superfamily ARM repeat 6.04e-32
Family MIF4G domain-like 0.0000168
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000019955
Domain Number - Region: 556-566
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000133
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019955   Gene: ENSMODG00000015988   Transcript: ENSMODT00000020312
Sequence length 1767
Comment pep:known_by_projection chromosome:BROADO5:4:357281452:357551416:1 gene:ENSMODG00000015988 transcript:ENSMODT00000020312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTQVARQPGPPTPSPYSAHEINKGHPNLAATPPGHASSPGLSQRYDFSPEDSFSCIPEI
LTPYPSGQNAAPTTLVYPQAPQTMNSQPQTRSPPSRTVPIHCTDNWKRRKVLEQTPVYRS
LAGRGWIKYCIFAAGPRPAHHQFFQRPQIQPPRATIQNSSPSIRPGAQTPTAVYQTNQHI
MMVNHLPMPYPMPQGPQYCIPQYRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGEFPNAY
GTPFYPSQPVYQSAPIIVPTQQQPPPAKREKKTIRIRDPNQGGKDITEEIMSGGGSRNPT
PPIGRPTSTPTLPQLSSQVPEHSPVVYGTVENTHLAAGTPVTAPSDPKQEEKPKPDPVLK
SPSPVLSLEPSGEKKEQAGPIPETTPVESIPELPPPSLSPTTMAPVALSTIPPPPAAVPL
CNLFTADGDDRCELASPKEDAIPLPSPIPCTEMSNPSPPHDIEEDVCKDPCSVAPNDIPV
IATTNLINEINGVSEKLTATESIVEIVKQEMLPLTVDLEILENSPEDIKMESISTPITLS
TVLSLSPSPPPPPPPPPPPPPPPPPPASPPPTPAAVPAALTTTSAPNVPAAVPGVLEEDE
NIRTALSDDTKDIQPKAEVEADGQTEEIVDSQNLNSRKSPVPAQTAVTAPKMWKKPKDRT
RTTEETLEAESEPKVEEELSGDKVLESEQDKMSQGFHPERDPSDLKKAKALEENGEQESE
PVRNGAESASEGEGVEANSGSPDSSGDGVAFPLKPEPWKPADTEGKKQYDREFLLDFQFM
PACIQKPEGLPPISDVVLDKINQPKLPMRTLDPRMLPRGPDFTPAFADFGRQTSGGRGVP
ICKVQSRHGLPVLEQGKAPTCTPLPMSHPPLKSLPLGLLNVGPRRSQPGQRREPRKIITV
SVKEDVHLKKAENAWKPSQKRDSLAEDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVA
ELTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLL
NRCQKEFEKDKADDDVFEKKQKELEAATAPEEKTRLHDELEEAKDKARRRSIGNIKFIGE
LFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEK
IVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEEQRKVQQLM
TKEKRRPGVQRVDEGGWNTVQGAKNSRVLDPSKFLKITKPTIDEKIQLVPKAQLGSWGKG
SSGGAKASETDSLRSGATSLNRFSALQPPVSSVSASSTPLEFDSRRALTSRGSMGREKND
KPLPSSTPRPNTFLRGSSSKDLLDNQSQEEQRREMLETVKQLTGGMDMDRGSAEADRSKA
RETAKPDVSTTPVPEKPTLSEEEMERKSKSIIDEFLHINDFKEAMQCVEELNAQNLLPIF
VRVGVESTLERSQITRDHMGQLLHQLVQSEKLSKQDFFKGFSDTLELADDMAIDIPHIWL
YLAELVTPMLKEGGISMRELITEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWRE
AGLSWKDYLPEGEDVHNFLLEQKLDFIESDCSSSSEALSKKELSAEELYKRLEKLIIEDK
ANDEQIFDWVEANLDESQMSSPTFLRALMTAVCKAAIIADCSTFRVDTAVIKQRVPILLK
YLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAFYKWESSKDPAEQ
SGKGVALKSVTAFFTWLREAEEESEDN
Download sequence
Identical sequences F7EZC3
ENSMODP00000019955 ENSMODP00000019955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]