SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020148 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020148
Domain Number 1 Region: 52-265,382-419
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.92e-60
Family Inositol polyphosphate kinase (IPK) 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020148
Domain Number - Region: 38-45,333-378
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00575
Family Formin homology 2 domain (FH2 domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020148   Gene: ENSMODG00000016132   Transcript: ENSMODT00000020505
Sequence length 420
Comment pep:known_by_projection chromosome:BROADO5:1:47222444:47291982:-1 gene:ENSMODG00000016132 transcript:ENSMODT00000020505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEPPAPRPRLPGPAPASPATPAGAPPAAPQPALPGSPPPPPPPLLNGCVPLSHQVAGH
MYGKDKVGILQHPDGTVLKQLQPPPRGPRELEFYNTVYAADCGDSVLLELRKYLPKYYGI
WSPPTAPNDLYLKLEDVTHTFNKPCIMDVKIGRKSYDPFASSEKIQQQVSKYPLMEEIGF
LVLGMRVYHAHSDSYETQNQHYGRSLTKETIQDGVSRFFHNGYCLRKDAIAASIKKIEKI
LQWFESQSQLNFYASSLLFVYEGSSLPTANRLGDGTSAEKAFWSKGQLPEAEVLEYNNNI
HLLSSKENGKVGASVGKVYVHHKEAYSKNHHGQTPLKVENGEQGNVWKSSNCISQEHLNG
NVLSQLEKVFYHRPAEPPESSLVEVRMIDFAHVFPSNTKDEGYVYGLKHLITVLQNILDN
Download sequence
Identical sequences F7DS89
ENSMODP00000020148 XP_001375711.2.35504 ENSMODP00000020148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]