SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020166 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020166
Domain Number 1 Region: 398-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 173-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 3 Region: 342-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.29e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 7-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.41e-21
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 6 Region: 135-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 7 Region: 304-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000912
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 8 Region: 220-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000611
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020166   Gene: ENSMODG00000016145   Transcript: ENSMODT00000020523
Sequence length 469
Comment pep:known_by_projection chromosome:BROADO5:4:354348836:354353644:1 gene:ENSMODG00000016145 transcript:ENSMODT00000020523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATLLMAGSQGPMTFEDMAMYLTREEWRPLDPTQRDLYRDVMQENYGNVVSLDFDIRSE
NETNPKVISEDIEFGNISGRPLESAHQNPECEEAFENGDKSEGQWGDLTGDDWVNYPLQQ
VTDLLVHKEVHGDIRFHICSQCGKAFNQISDLNRHQRTHTGERPYKCYDCGKSFSRSSHL
IQHQRTHTGEKPYDCSECGKSFGRSSHLIQHQTIHTGEKPHKCNECGKSFCRVSHLIQHQ
RTHSGEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYECNECRRSFSERSDLIKHYRVHT
GERPYKCDECGKNFSQNSDLIRHRRAHTGEKPYRCNECGENFSRISHLVQHQRTHTGEKP
YECNECGKSFSRSSHLITHQKIHTGEKPYECNECWRSFGERSDLIKHQRTHTGEKPYECV
ECGKGFTQSSNLITHQRVHTGEKPYECTECDKSFSRSSALIKHKRVHTD
Download sequence
Identical sequences F7D7E4
ENSMODP00000020166 XP_001375949.2.35504 XP_007491248.1.35504 XP_007491249.1.35504 XP_007491250.1.35504 XP_007491251.1.35504 XP_007491252.1.35504 XP_007491253.1.35504 XP_016277547.1.35504 13616.ENSMODP00000020166 ENSMODP00000020166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]