SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020167 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020167
Domain Number 1 Region: 145-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.05e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 243-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-22
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 4 Region: 7-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-21
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020167   Gene: ENSMODG00000016145   Transcript: ENSMODT00000020524
Sequence length 301
Comment pep:known_by_projection chromosome:BROADO5:4:354348836:354353644:1 gene:ENSMODG00000016145 transcript:ENSMODT00000020524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATLLMAGSQGPMTFEDMAMYLTREEWRPLDPTQRDLYRDVMQENYGNVVSLDFDIRSE
NETNPKVISEDIEFGNISGRPLESAHQNPECEEAFENGDKSEGQWGDLTGDDWVNYPLQQ
VTDLLVHKEVHGDIRFHICSQCGKAFNQISDLNRHQRTHTGERPYKCYDCGKSFSRSSHL
IQHQRTHTGEKPYDCSECGKSFGRSSHLIQHQTIHTGEKPHKCNECGKSFCRVSHLIQHQ
RTHSGEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYECTECDKSFSRSSALIKHKRVHT
D
Download sequence
Identical sequences F7D7D6
ENSMODP00000020167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]