SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020355 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020355
Domain Number 1 Region: 887-897,924-1291
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.44e-99
Family Formin homology 2 domain (FH2 domain) 0.0000126
Further Details:      
 
Domain Number 2 Region: 29-100
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-16
Family PDZ domain 0.025
Further Details:      
 
Domain Number 3 Region: 110-182
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000723
Family PDZ domain 0.01
Further Details:      
 
Domain Number 4 Region: 367-423
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000802
Family PDZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020355   Gene: ENSMODG00000016282   Transcript: ENSMODT00000020712
Sequence length 1302
Comment pep:known_by_projection chromosome:BROADO5:6:143076106:143255519:1 gene:ENSMODG00000016282 transcript:ENSMODT00000020712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKFLKSRKDKYSVTKITAIKKPVIPEFRTVMPVSNQGWPEEFGFRIGGNGPCYILQVEE
GSSAHLAGLQPGDQILEIEGQPVTSLNFQSLMSLAQQCENVPPSIGVVSRVQQIELPSGP
NGSFGFTLLRGTPLQVGSVSAGSPAEEAGLKAEDYILEINGIPVRQYEMANLLIESCQGK
ALGLGLLKLGKHNRSYSSSSSDSSSSIPEFVQSPEAVHLERRHKAKEFNKKVDEILGDKP
ELKEKVFAVLKQYASERKVDYLAYALSMILTNEDHQMLIDNIRIFIPKKHRQRFDEVVSQ
SLISKLCRTKRGQQTHRLRRSRSEDHPERLMVSTRASSVPRGPEDVGKGLRKTTSLIASR
VGSGAARRTVRVYKGNKSFGFTLRGHAPVWIESVLPGDPAENASLKPGDRILFLNGLDMR
AMMTAEPEWEKCHLASGESETRTSFLLPCASIDSDSLDSPNPSSALTSLQWVAEILPGSI
RIQGKTFSQQLEHLLTPAERYTICRALECFFQHRNIDTLIVDIYPVLDTPAKQVLWQFIY
QLLTYEEQEHCQQKIARFLGYKSMTGKQQDSGSITDATTSESDTEERPQSSLRVASICRG
SMRNQGSEGVNIGPSESVEIPISLTAGERQAGDGTSLPETPNPKMMSAVYAELETRLSSS
FKGKMGSISKPRASPPVVEPPSIPGILCLALLSGPSISWPNDPLPPQPCYYHPCPGSLPS
PSSTESHPYVSLDSSPAPSPQLTAMASSPSPPTCRKKLFTFSRPPRNRDTDRFLDALSAQ
LGARVTMVDDFLTPENDYEEMSFLDDQGSYVTNDLSSVSEYVSSSEEGSSLTYSSISDHI
PPPPLSPPPPPPLQFHDPKPAAPRNLDGPHNPATLAKPLGAHSHQVPPPPPPPLPPPVPC
APPLLHRGLSHRRSESNHMSVKRLRWEQVENSEGTIWGQLGEDSDYDKLNDMVKYLDLEL
HFGTQKPAKPTLAPEPFKKKDVVEILSHKKAYNTSILIAHLKLSPPELRQILMNMDSERL
EPSHLKQLLLYAPDTEEEKRYQGYRDTPSQLSEPDQFVLQMLSVPEYKTRLRSLYFKTTL
QEKTEEIKGSYECVHQASLELKNSKKLAKILEFVLAMGNYLNNGQPKTNKTTGFKINFLT
ELNSTKTVDGKSTFLHILAKSLSQHFPELLGFAKDLPTVPLAAKVNQRMLTTDLTDLHIT
ISEIQTACQKMPATSDDKFALVMTSFLEMAQPAVRALDTLQHKAMEEFSRVLSFFGEDSK
VTTSEAFFGIFAEFMSKFERAFSDVQVCESQRSSGMASPLAW
Download sequence
Identical sequences F7AUL4
ENSMODP00000020355 ENSMODP00000020355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]