SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020384 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020384
Domain Number 1 Region: 175-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-17
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 147-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000585
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 3 Region: 217-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000529
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020384
Domain Number - Region: 116-158
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00541
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020384   Gene: ENSMODG00000016309   Transcript: ENSMODT00000020742
Sequence length 259
Comment pep:known_by_projection chromosome:BROADO5:1:496042069:496050216:-1 gene:ENSMODG00000016309 transcript:ENSMODT00000020742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKKHFSTSKKPNYSELESQTVIVSPHLYDQSYPMLAIPAPEVLSPAICYPPLVW
ESGLLSSFFTSMPAAAPGPPEEPKALDLTSLSSDDYDSGKGSDPPSPVSQEEEAEKFPCG
QCPESYTTLPSPSKHQQLQHSEDTQPRKAFICKVCEKEYVSLGALKMHIRSHTLPCVCKI
CGKAFSRPWLLQGHIRTHTGEKPFSCTHCSRAFADRSNLRAHLQTHSDVKKYQCKTCSRT
FSRMSLLHKHEETGCSGSR
Download sequence
Identical sequences F7A665
XP_001378890.1.35504 ENSMODP00000020384 ENSMODP00000020384 13616.ENSMODP00000020384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]