SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020408 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020408
Domain Number 1 Region: 783-1186
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.79e-41
Family Tandem AAA-ATPase domain 0.054
Further Details:      
 
Domain Number 2 Region: 298-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000283
Family Classic zinc finger, C2H2 0.086
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020408
Domain Number - Region: 356-381
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0785
Family CCCH zinc finger 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020408   Gene: ENSMODG00000016327   Transcript: ENSMODT00000020767
Sequence length 1258
Comment pep:novel chromosome:BROADO5:1:495217320:495235421:-1 gene:ENSMODG00000016327 transcript:ENSMODT00000020767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLVPEGVLPRLSGYFIASPTILGQEVMIRQKVLLKELQNHLEFLVGCSVCAKQMNETTY
IWQIIDHHCSGEILLARVKGTPPHQGWRKVRRRPIFPNPRRYEECHYYRPGIGCRRHNQC
TLASSPEEALVWTFERQNCIPRLWLKARVQKSWHCQNPKNQRTVEKIWAEFGGYFQEICK
ACFESCPQRVTLRAPNLMCPEHLSSGSILVHRTSEDQMVEIRPKPRRRRLLLEYCMVVSK
GKPCQYGATNCIYAHSDVEMAVWEAETMDYLFRPDLIQARIESEGRAGTSGEDSADVSPV
FPPQIELYCQTCHVTFSSKESLKKHCSSLEHIQRVSYDKGALWEYQPPTIGVSEFKLCPR
QDMCPYKDGCAKAHSLGELQEWILRAQTVQMREDLAWKHGFFFSQDWLFHEYQDSGTDVL
LRKRSVGDINMYCSQPLQCQEEDKKSHCSWKFIIHSKNRQPLRCVALLKHHMGAVFFLVG
PGLPPGQAYAQGSRFRVYGAAVMTFHVEVHVECVTSGSYDQWVTFAFERGPLLVQKLRLQ
VAPEILPTCVQNHDCLLEMTHWHSGNRCVVPSVARTAEQVKLLAKYNVSSQELGYYKLMT
AAQIPITQANYRDRMHQFLFVEEEAQQQLVDRLNLQVHGTLISKVQTLAMGMKFDIQGKV
YVKGQIPCSLTPDTDHGFLLSRAINTAYISPIPSPDNRVYEIQVKANITSERNVWLLLPA
HCWSSLWLEIRDSQLLEIQFQIDRMVFGMWHQAIDALYDERVVIPNIPACSLPSLMLPTQ
EISCNEKQKQAISYITGTASEKTQVPPLLICGSFGTGKTYTLAWASLEVIKQPNTKVLIC
TYTNSAADVYIREYFHSYATAGHTEAVPLRVKHSESLLHETDLTTLQYCCLSEDGSSFRF
PTQDELEQHPIIVTTTTLSHNLRVPPGFFSHILIDEADQMLEWEAIMPLAYATQGTRIAL
AGDHLQRTPTLFNIRDRKSADYSLFNRLFQYYEQETHKLASQCKIIFHKNYRTTKAIIPF
LLHNFYGSSKIHVEDSGIPEHPWQYPLMLCYMPGTPERDISMTSWLNKAEIVGVIKRVQE
FYHGWVCQWGSPDQKQICVVSSGSQVHRLREELRKKQLGEVVVENAENVPGREFRVVIIS
TVHTQDSLLSNSATHLEFFNEPQLLNTVMTRAQSQLVVVGDPMALCSFGHCKEIWKDFIL
KTFEQGNVFPAFLKKTDVEQSSLLCLAWQNRLISGAAAREDFLKEEEDNHNVTTSLGV
Download sequence
Identical sequences F7FL29
ENSMODP00000020408 ENSMODP00000020408 XP_007475809.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]