SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020452 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020452
Domain Number 1 Region: 785-842
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.14e-26
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 898-954
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 617-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.46e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 841-898
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 505-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 7 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.19e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 8 Region: 729-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 9 Region: 171-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.16e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 10 Region: 561-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 11 Region: 674-730
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.78e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-20
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 13 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 14 Region: 943-995
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-19
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 15 Region: 134-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 16 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.27e-17
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 17 Region: 395-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000126
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020452   Gene: ENSMODG00000022833   Transcript: ENSMODT00000020812
Sequence length 1000
Comment pep:novel chromosome:BROADO5:Un:9246779:9253600:1 gene:ENSMODG00000022833 transcript:ENSMODT00000020812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQESLTFRDVAVLFTWDEWRRLGPAQRSLYREVMLETFEHLVALGLPGFRSDVISRLERA
LHPHALLMAVAEGSSPEAPETPRAPAWPLSRGHRELPSFPNDYKRMYSQKKLHISNESRK
IFTLHPRVPSAKEPFYCNECGKAFRWRCKLNTHQRIHTGEKPFECKECGRAFRDKSYLLL
HQRIHTGEKPFECSECGKNFSLKSSLILHQKIHTGKKLFECNECRKAFHYKCCLTLHQRI
HTREKPFECNECGKAFMWKTQLNKHKRIHIVEKPFESDNCIKTFSLKGILTEHQRIPMEE
KRFECNECDKAFRWQCKLTAHQRIHTGEKPFECRECRKTFHEKSCLTLHQRIHTGEQPFE
CDECRKNFSQRSSLILHQRIHTGEKPYECNECGKSFMWKSQFNKHKNIANGKKSFECSVC
RKIFHDKSHFTVHQRIHTGEKPFECRMKAFCDKSHLTVHQRIHTGEKPFECKECGKTFSQ
SSSLSSHQRIHSGEKPFECNECGKAFRDKSHLTVHQRIHTGEKPFECKECGKNFTLRSSL
SSHQRIHTGKKPFECNECEKAFRDKFHLIEHQRIHTGEKPFECKECGKTFHNKYQLSVHQ
STHTGQKPFVCIECKKTFISKSQLNKHKRIHTGEKPFECDNCGKAFTRKDHLTEHQRIHT
GEKPYECAECGKNFSQRKSLTFHHRIHSGERPFECTECGKNFNYKKSFLFHQRTHMGEKP
LECNECGKSFHNRSQLVVHQRIHTGEKPFGCHECGKAFYNKSQLNVHLRTHTGEKPFKCN
ECEKAFHHKSQLVAHQRIHTGERPFECNECGKAFHNKSQLTVHQRIHTGEKPYKCNECGK
SFSHRKSFIFHLRIHTGEKPYECNECGKAFHNKSHLTVHQRIHTGEKPYECNECGKKFSL
SSSLTKHQRIHTGEKPFECSECGKNFSRKSSLILHQRIHTGEKPFECNECGRNFSQRSSL
VSHQRTHTGEKPFECNECGKNFTRRSLLSKHKTIHTGENP
Download sequence
Identical sequences H9H6U1
13616.ENSMODP00000020452 ENSMODP00000020452 ENSMODP00000020452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]