SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020462 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020462
Domain Number 1 Region: 198-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 239-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000614
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020462
Domain Number - Region: 156-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000461
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020462   Gene: ENSMODG00000016375   Transcript: ENSMODT00000020823
Sequence length 502
Comment pep:known_by_projection chromosome:BROADO5:6:145694300:145738138:-1 gene:ENSMODG00000016375 transcript:ENSMODT00000020823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSLDEPLDLKLSITKLRAAREKQEWALGAVRHRALHRELGLVDDGPAPASPGSPPSGFL
LNPKYPEKGDGRFSAAPLVDLSLSPPSGLDSPSGSTSLSPERQGNGDLPPTPAAHVSLGY
GHQGGPSMKRFRLIVEYKEPPEVHMGLTVSPHLSLQCNQLFDLLQDLVDHVNDFHVKPEK
EAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNEKPHRCPTCNKSFSRLENLKIHNRSHT
GEKPYICPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGCHKRYTDPSSLRKHIKAHG
HFVSHEQQELLKLRPPPKPQLPTPDSPYVSGAQIIIPNPAALFGGPGLPGLPASLPLPLA
PAPLDLSTLACGGGSGVGPGLPGPVLPLNLAKNPLLPSPFGAGGLSLPVVSLLAGSAGGK
AEGEKGRGVVGAKALGTEGRKIAGERTEGGRARSGPDGLSLLPGTVLDLSTGVNSAASPE
ALPPGWVVIPPGSVLLKPAVVN
Download sequence
Identical sequences F7ER90
ENSMODP00000020462 ENSMODP00000020462 13616.ENSMODP00000020462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]