SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020476 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020476
Domain Number 1 Region: 939-991
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 427-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.93e-16
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 625-676
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000505
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 662-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000358
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020476   Gene: ENSMODG00000016387   Transcript: ENSMODT00000020837
Sequence length 1125
Comment pep:known_by_projection chromosome:BROADO5:1:493537180:493554982:1 gene:ENSMODG00000016387 transcript:ENSMODT00000020837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVPAEGGYFPTLGICCEGENNCYNFAPDARTMSRRKQAKPQHINSSEEPQQFPDAAACA
SVAAASSATTPAAAAADHGGPPNCPGDGDGIKGRVKRCRTEETNICEKCCAEFFSLSEFL
EHKKNCTKNPPVLIMNDSEGTAPPEVFAEITSAPSESFPVDRLESQSSKESRSKNCTGSV
DKKEKSGVETGTYLKTEPTIPPTPHGISYLPKGKVPNTNVTLQTLRGTKVAVNQRSADAV
SLPVQGFSTFPMILEQLMSLQQQQLQQIQLTEQIRVQMTMMATSGHPSVSHGSDPLKTLG
THMSQHLSTALALVGQKAGSQSLSLESLKQGKLPHANIGIPTAGSVASGIPSFSLKPDAN
RILPNAMSRLPNPLLPQSSGSVLFQNPFPPVSSVSSVLDSSKKGKGKPPNITVSESKPNA
EEPFFKHKCKFCGKVFGNDSALQIHLRSHTGERPYKCNICGNRFTTKGNLKVHFQRHKDK
YPQIKMNPLPVPENLDNLTSASGMSCGITAIPLDESNLIVDSKPPLTTGAPSLGLPQSLS
SLTPKDSLSGAFPSDLPSRPSPESEGGSTSSGVASHESGTEQSLSSPQAGSSIGGFPGSG
ATEQGSETLKLQQLVENIDKATSDPNECIICHRVLSCTSSLKMHYRTHTGERPFKCKICG
RAFSTKGNLKTHYGVHRANTPLKMQHSCPICQKKFTNAVVLQQHIRMHMGGQIPNTLMPE
NSCDHVDMDPAVIGEKNGDAIANCIDETIESIVDMEDLDSQDVPSGSSKPSTPFPDAQSE
TPAGAFTIVSEAPGKMGNPPLSLQRQSSLKSSSAESDGMTNDSSSVMGDQDYQNGRSPES
ASFQALSPTNSQAESIRSKSPGLTNHDDMGNKAEGPENPPAETEGRGNIPATFVRMPPAL
IKAEAPGERPVSNNPFSGPPALSPGVTPLLVAPPRRTAKQHICTTCGKNFSSASALQIHE
RTHTGEKPFACTICGRAFTTKGNLKVHVGTHMWNNSARRGRRLSIDNTIALLSNDVKKVS
EMFPKDIVPPAVNLDSAVWNQYAAVINNGLAMKTNEISVIQSGPIPALPVPVSGGGSVMN
NAPVSKIDGSQSGISSDVIEKASATDSVPKHQFPHFLEENKIAVS
Download sequence
Identical sequences F7E9H3
XP_007475783.1.35504 ENSMODP00000020476 ENSMODP00000020476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]