SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020479 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020479
Domain Number 1 Region: 161-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-17
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 215-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-16
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 3 Region: 268-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000293
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 370-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000243
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 327-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000352
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020479
Domain Number - Region: 435-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000168
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number - Region: 27-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000556
Family C2HC finger 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020479   Gene: ENSMODG00000016390   Transcript: ENSMODT00000020840
Sequence length 693
Comment pep:known_by_projection chromosome:BROADO5:1:493177781:493201285:1 gene:ENSMODG00000016390 transcript:ENSMODT00000020840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNASGGGEGFPGSVQFPGGTTVLVELTPDIHICGICKQQFNNLDAFVAHKQSGCQLTSAT
PGTPSTVQFVSEETVPATQTQTTTRTITSETQTITVSAPEFVFEHGYQTYLPTDSSDTQT
ATVISVPPKSRSRKPATSPAQKKLNCCYPGCQFKTAYGMKDMERHLRTHTGDKPHKCEVC
SKCFSRKDKLKMHMRSHTGVKPYKCKNCDYAAADSSSLNKHQRIHSNERPFKCQICPYAS
RNSSQLTVHLRSHTGDAPFQCQMCSAKFKINSDLKRHLRVHSGEKPYKCEFCEVRCAMKG
NLKSHVRIKHNTENTFKCAECDFQCSNKTSLRHHTRTHQPEQPVKCTECSYSCAHKAALK
VHERIHCEERPFKCDFCSFDTKQRSNLTTHVKKVHSDKVKSKKPSLEKKGGGGGAGRGDR
AKASGSSQVAKLDAKKAFQCDACEASFVREDSLRSHRKQHSEYNGNKSAELAVLQLQMES
GRPVGTPLTVSPLQVPLQPSQIPQFSEGRVKIIVGHQVPQPNAIVQATSVNIVPPALGGQ
GQEDLPSNNRLQILRQVSLIAPSQPAVCQNEAGPIGQPGAVLLTTHDQTEGTALHQTLIP
APSATNHEGPTSQTFITSSGISCSDLEGLNALIQEGATEVTVVSDRGQNITVSTTAPPIF
SSSSHQELPKQTYSIIQGGAHSALLCPADSIPD
Download sequence
Identical sequences F7E9E6
ENSMODP00000020479 XP_003339756.1.35504 ENSMODP00000020479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]