SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020481 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020481
Domain Number 1 Region: 487-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000024
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 2 Region: 122-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000599
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 379-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000474
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020481
Domain Number - Region: 210-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00588
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 54-84
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0119
Family Classic zinc finger, C2H2 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020481   Gene: ENSMODG00000016392   Transcript: ENSMODT00000020843
Sequence length 1069
Comment pep:known_by_projection chromosome:BROADO5:1:491752186:491771271:1 gene:ENSMODG00000016392 transcript:ENSMODT00000020843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NMPTQPLLAYIDGPDVIASTVDSRMEINDASISIKGTNTISYKSLQDKFLIQAEGCMPLD
CMFCEQTFKHPEDLSKHVLMQHRPTLCEPAVLRVEAEYLSPLDKSQVRTESLKENGKENE
EFSCEVCGQTFGGAFDVETHMKKHKDSFTYWCSVCGRRFKEPWFLKNHMRTHTGKPGSRN
KLQQGLDSPITINEVVQEQVAEIVTSPYKICMVCGFLFPNKDSLIEHSKVHTKESVSTSE
TQTVDSNEGGMSSQREEFLQLLNLRPNPTPEKVKKPAKWIAELDPFNTYQAWQLATKGKV
AISRGEVKEPGQEGSTDNDDSCSDKEELGEIWNANKSHTESTGKPKTNKNNCAGIGLSQD
KEKIKHTSGEVPSMDVDPKLSHNKEKPTHCSECGKVFRTYHQLVLHSRVHKRERRTDAES
PTSIEGRQHRTYSPDLATALDENGTIDRVEGGSEDGSEDGLSEVLHLDKNEDGLERGKIK
HLASSRECSYCGKYFPFNLYPSYHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHHKDK
QIDITTEAKNDGKSSLLSRETEDMLLTTDGAQTKNLKRLFDGAKDTKGCTPAKQHKEMPS
AFHNVLGSVHSTINKDTQDSSKNIVDDSTDKMNKSVVTPYLDKLKKKSLIESQANNSVCK
TEKDSLLSGRGDTIYGSEVNNIDEIKESTPNCKHKPNMDFEEKPLNLSVGSAQECAAVSI
SRGLLATSTCPFCTYRTFYPEVLMMHQRLMHKYNPDIHKNGRNKSSVKSRRTGCPPALLG
KDVPPLSTSSHKSKISLATQSKSLQPEKVKLCPPLPSKVPLSSGIDSSTLAPSNLKSHRP
QQNIGAQAGVIRQQSEMHSKTSASSVPDRIKRPETKLKSLSISPQPGIVGSNVNGSFDYP
LKSDSPWSSNQGREYFCNRNVGNVNVEFGEPSSKRIKSNVVTLELDSATVANYRREYDIN
RYRVASRIANLLPQDCPCPPASVLPTKQGVLNSNEVDSPNVLTVLKSYEPYGPGPLYSSC
GSSGSQASSSAIEGKRPMSYQQLSNSMLQKRNYENLITNTHYRPNDKKT
Download sequence
Identical sequences F7E919
ENSMODP00000020481 ENSMODP00000020481 13616.ENSMODP00000020481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]