SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020519 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020519
Domain Number 1 Region: 30-120
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.78e-38
Family SCAN domain 0.0000726
Further Details:      
 
Domain Number 2 Region: 751-808
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.87e-25
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 807-864
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 849-901
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.87e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 5 Region: 224-272
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000222
Family KRAB domain (Kruppel-associated box) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020519   Gene: ENSMODG00000016425   Transcript: ENSMODT00000020882
Sequence length 924
Comment pep:known_by_projection chromosome:BROADO5:6:146984101:147002294:1 gene:ENSMODG00000016425 transcript:ENSMODT00000020882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALGHQVQAPQKNSTWGQKAALQVEVTTDSEAFRQQFRQFCYQEVGGPHEAFSTLWEL
CCRWLRPKTNSKEQILEMLVLEQFLTILPGEIQVQVREHRPENGEEAVALVEDLQKETER
PEEQFSVSVQNPEVLVEKIVPVGAAQESVSYQLKQEENQQDEDPSKDTSWSPHEGSQDQA
DYKQDPQLRPETTRLLAGDTPQVSAFSQERRMRNQEMEAVILTTGFQEPVTCEDVTVPLS
QEEWRCLNSAQRVLYKGIAQEKFRNVDSVGLPKSLLISGMNHGKDICIPDLQGSKETEIL
SSSHTNENRVQADEKQANREGKNWGDQRQQELADEKISGMCSFEETKPFLSIHNESWVWE
SEPISRKTKMNTINYVFVCESISISVNCGVIKCLPKGPKIGLCLFLWHHQKKKLAFGHTL
NLDTLSSLFSFKQPRTLGMRMGQKLDRIQIKYFGKILDFSPPASTYIKSSLLRGSGLDLY
FKDMHKGYEETKTCIFIFRKCQCYEMEASYTLARYMEASIAILNQIQVSTQPIKNKKRPC
VYMEMHALLSSLSSGLTLKFLAKVAFLIRVERITLDSKTSKKSIWYEFLSSRRVVRKRLG
WTKCIEIHSIFETDILGIKSPCWLISLSYLNCFKRKNEIKKENLKWEFSEEQLSRTVQGK
FNRQIFQYPVLKEACETVSKLRKQLISFPREKQGKPAFQERDLMKQLDQQKLFVGEKHHK
QLACGNSFSQNFHKSAPELEKTTKCQQCGKSFSRGSYLVRHRRIHTGEKPHKCNECGKSF
SERSNLTAHLRTHTGERPYKCGECGKSFNQSSSLIVHQRTHTGEKPYQCNECGKRFNNSS
QFSAHRRAHTGESPYKCRECGKSFNNSSHFNAHKRTHTGEKPYECSQCGRSFGKSSALTR
HQGVHMREKFLIQSRINVLEGDIS
Download sequence
Identical sequences F7ASR7
ENSMODP00000020519 ENSMODP00000020519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]