SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020558 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020558
Domain Number 1 Region: 203-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 315-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-22
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-20
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 160-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 360-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 108-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000014
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020558   Gene: ENSMODG00000027752   Transcript: ENSMODT00000020923
Sequence length 417
Comment pep:novel chromosome:BROADO5:6:147606687:147611075:1 gene:ENSMODG00000027752 transcript:ENSMODT00000020923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNVDRSFHSGTKDTKEEEIPMGERLPEKESDWIFSGAYTGNEEFYMLPSAELAKVPSQS
PEAKEPQGVPLDQSAEVILDKRWKQTTSWEKQLKPFFFSPQGSIPQGTPYDCADCGKRFC
LKSNLLTHQKTHSGRRLYQCPQYGDSFGDYTSLSTQQKDHSGERSHPCPECGKCFSDATN
LNTHLRIHTGEKPYECPVCGKHFSQSSGLIRHQRTHTGEKPYTCSECGKGFRQSSDLVEH
HRIHTGEKPYTCGDCGQSFSRPSNLVHHQRTHTSERIFCCIECGKSFQHSTSLSRHRKTH
TGEKPYKCPECGDNFSQSSNLLTHQRSHTLEKPYKCPHCGKSFNRASNLLQHQQTHSSDK
PYKCPHCEKAFSRSSNLITHQGTHTGEKPYKCFQCGKGFRSGSNLIQHQETHMGDKS
Download sequence
Identical sequences F6ZER0
XP_007499185.1.35504 XP_007499186.1.35504 XP_016279607.1.35504 ENSMODP00000020558 ENSMODP00000020558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]