SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020572 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020572
Domain Number 1 Region: 361-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 249-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-24
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 3 Region: 305-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-22
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 196-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.88e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.32e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 6 Region: 403-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.74e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 433-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020572   Gene: ENSMODG00000023366   Transcript: ENSMODT00000020937
Sequence length 488
Comment pep:novel chromosome:BROADO5:3:527002112:527012867:-1 gene:ENSMODG00000023366 transcript:ENSMODT00000020937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSLTFKDVAVDFTQEEWCLLDHSQKELYLEVMLENVQNALSLGLQVPRENFISYFHQGKA
PRMLEQKGPKSYCPEAKTNFEVKEMSKKLSRFVKGSGPQGCINEGLHDFILREICDSNIK
VNKSPKSVCEVDETAEKFSQYSDLNQYMKLTSGNDGCQNSVYSRCFPEEVGCVQHPKSKH
INMVSVSEKGSQPLSQNSELAAHQRIQDGEKPYECKQCGKTFKRKGHLAAHQRIHSGEKP
YECKQCGKAFTQRSNLAAHQRIHTGEKPYECKHCGKSFTWKVSLAAHQSIHTGQKPYECK
HCGKTFTDKRSLATHQRIHTREKPYECKHCEMAFTWKISLASHQRIHTGEKPHECKHCGK
AFTTKVTLAAHQRIHTGEKPYECKQCGKAFTERSHLSAHQRIHTGEKPYECKHCGKAFTQ
RGSLAAHQRIHTGEKPYECKHCGKAFTERGSLAAHQRIHTGEKPYECKHCGKAFTKRSSL
AKHQRIHT
Download sequence
Identical sequences F6ZDK4
13616.ENSMODP00000020572 ENSMODP00000020572 ENSMODP00000020572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]