SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020575 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020575
Domain Number 1 Region: 602-659
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.69e-27
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 98-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.99e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 210-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 463-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 154-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 266-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.92e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 322-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.71e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 10 Region: 43-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 11 Region: 1-52
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-16
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 12 Region: 658-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000162
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 13 Region: 565-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000444
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 14 Region: 369-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000632
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020575   Gene: ENSMODG00000022758   Transcript: ENSMODT00000020940
Sequence length 711
Comment pep:novel chromosome:BROADO5:Un:37130722:37155161:-1 gene:ENSMODG00000022758 transcript:ENSMODT00000020940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGEKFYKCPQCRKAFNKSSKLILHQRIHVGENPCECNVCGKGFHHRSKLKIHRRAHTRKN
PYQCNDCGKMFINDSKLILHQRIHTGEKPFKCNDCGKVFSHRSKLIIHQRIHTGEKPFKC
HDCGKAFNQNSYLLQHQRIHTGEKPFKCDDCGKAFNQNSHLLQHKRIHTGEKPFQCHDCG
KAFNQNSNLSVHQRIHTSERPFQCNDCGKAFNRSSHLLQHQRIHTGEKPFKCDDCGKAFN
QSSHLLQHQRIHTGEKPFQCHDCEKAFNQSSHLLQHQRIHTGEKPFQCHDCGKAFNQSSY
LFQHQRIHTGEKPFQCHGTGKAFNQNSNNYVHQRIHNSERLFKCNDCGKAFKQSSHLLQH
QRIHTGEKPFKCNDCGKAFNQNSNLSKSTNMYTGEKFYKCPQCRKAFNKSSKLILHQRIH
VGENPYECNVCGKGFHHRSKLSIHQRAHTRKNPYQCNDCGKMFINDSKLILHQRIHTGEK
PFKCHDCGKAFNQSSTLLQHQRIHTGEKPFKCHDCGKAFNQSSTLLQHQRIHTGEKPFKC
HDCGKAFNQSSNLLQHQRIHTGEKPFKCDDCGKAFNQNSHLLQHQRIHTGEKPFLCHYCG
KAFNWISNLLQHQRIHTGEKPFKCSDCGKTFNQNSNLIKHQRIHTGEKPFKCNDCGKAFN
QSSNLIVHQRIHTEKVIKHECGKDFNKRTNFLVHQRIHTGEEPYKCEGCEK
Download sequence
Identical sequences H9H6V9
ENSMODP00000020575 13616.ENSMODP00000020575 ENSMODP00000020575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]