SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020581 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020581
Domain Number 1 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-26
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 57-114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-26
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 229-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 173-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 117-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 6 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 383-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 2-40
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000742
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020581   Gene: ENSMODG00000002515   Transcript: ENSMODT00000020946
Sequence length 435
Comment pep:novel chromosome:BROADO5:Un:52305746:52307410:-1 gene:ENSMODG00000002515 transcript:ENSMODT00000020946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKNPYQCNDCGKMFINDSKLILHQRIHTGEKPFKCNDCGKRIHTDEKPFQCHDCGKAFNQ
NSHLLQHQRIHTGEKPFKCDDCGKAFNQNSNLSVHQRIHTSERPFQCNDCGKAFNRTFKQ
SSHLLQHQRIHTGEKPFQCHDCGKAFNQNSNLSVHQRIHTGEKPFQCHDCGKAFNQNSHL
LRHQRIHTGEKPFKCNDCEKAFNRSSHLLQHQRIHTGEKPFKCNDCEKAFNRSSHLLQHQ
RIHTGEKPFKCDDCEKAFNRSSHLLQHQRIHTGEKPFKCNDCEKAFNQSSHLLQHQRIHS
GEKPFKCDDCEKAFNQSSNLLQHQRIHSGEKPFKCDDCGKAFNQNSHLLQHQRIHTGEKP
FKCNDCEKAFNQNSHLLQHQRIHTGEKPFQCHDCGKAFNQSSNLLKHQRIHTGEKPFKCN
DCGKAFNRSSNLIVH
Download sequence
Identical sequences H9H6W2
ENSMODP00000020581 ENSMODP00000020581 13616.ENSMODP00000020581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]