SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020611 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020611
Domain Number 1 Region: 311-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 373-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000823
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 3 Region: 498-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000108
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 444-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000159
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 274-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000439
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 6 Region: 560-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000128
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 477-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000266
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020611   Gene: ENSMODG00000016490   Transcript: ENSMODT00000020976
Sequence length 668
Comment pep:known_by_projection chromosome:BROADO5:1:486246718:486269180:1 gene:ENSMODG00000016490 transcript:ENSMODT00000020976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTEASASPEHFTKIKGTDLIQEKAKESDVDKVSRLKERQSSCGLEVDCSYGVLQAKIVE
GELELTPQTQENEKHILTLQTVHFATDEMDHQEMTVEPAEGMHVMVQQGESGLQSLLVLQ
QDINVESELNEIPHQNLHHCVAISIQEEVFSLHELEVMEINVVEESVEISSEEDKLTVNP
PLDENTESVKDEGKDIYRAEDEVPQLCEEREITDQKEGLFTFDKLREGEKEEIILLPANS
EIEEHEDIPSSEQDTDEVSGTAKNQAKTKDVKQTFHCEICIFTSSKISCFNRHMKTHSDE
KPHMCHLCLKAFRTVTLLRNHVNTHTGTRPYKCSDCDMAFVTSGELVRHRRYKHTHEKPF
KCTMCKYASVEASKLKRHIRSHTGERPFHCCLCNYASKDTYKLKRHMRTHSGEKPYECYV
CHARFTQSGTMKIHILQKHSENVPKHQCPHCATVIARKSDLRVHLRNLHSYKAAEMKCRY
CTDVFHERYALIQHQKTHRNEKRFKCDDCSYACKQERHMRVHKRTHTGEKPFTCLSCNKC
FRQKQLLNVHFKKYHDKNFIPTVYECPKCGKGFSRWNNMRKHSELCEVIRGKAVQSAKGR
KTKKKKQKGPKQDVKEEVEQMPIEDISNVNIERHTNEIVPVGYGIATDVAEEQKTEVTCE
MILNMMDK
Download sequence
Identical sequences F7EQE3
XP_007475736.1.35504 XP_016283832.1.35504 XP_016283833.1.35504 ENSMODP00000020611 ENSMODP00000020611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]