SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020645 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020645
Domain Number 1 Region: 87-143
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-21
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 2 Region: 130-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 48-100
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-19
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 195-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-19
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 234-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.79e-18
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 2-46
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-17
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020645
Domain Number - Region: 283-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0182
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020645   Gene: ENSMODG00000016538   Transcript: ENSMODT00000021012
Sequence length 304
Comment pep:novel chromosome:BROADO5:Un:37553322:37651826:-1 gene:ENSMODG00000016538 transcript:ENSMODT00000021012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDHLIYHQEIHTGEKPFQCNKCGKAFSRKGHLLIHQSTHTGEKPFELKPFECNECGKAFS
QKWHLIRHQNIHTGEKPFEGKECGKIFRVREVLVRHQMTHTGEKPLECNECGKAFNQKGH
LTIHQSNHTGEKPFEGNECGKTFTFKRKDHLIYHQEIHTGEKPFQCNKCGKAFSRKGHLL
IHQSTHTGEKPFELKPFECNECGKAFSQKWHLIRHQNIHTGEKPFEGKECGKIFRVREVL
VRHQMTHTGEKPLDNECGKAFNQKGHLTIHQSNHTGEKPFEGNECGKTFSERQHLLKHQR
THTE
Download sequence
Identical sequences H9H6Y4
ENSMODP00000020645 ENSMODP00000020645 13616.ENSMODP00000020645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]