SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020653 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020653
Domain Number 1 Region: 537-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000198
Family Classic zinc finger, C2H2 0.069
Further Details:      
 
Domain Number 2 Region: 586-620
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000863
Family CCCH zinc finger 0.0038
Further Details:      
 
Domain Number 3 Region: 199-228
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000301
Family CCCH zinc finger 0.005
Further Details:      
 
Domain Number 4 Region: 472-504
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000801
Family CCCH zinc finger 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020653
Domain Number - Region: 328-359
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00111
Family CCCH zinc finger 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020653   Gene: ENSMODG00000016546   Transcript: ENSMODT00000021020
Sequence length 680
Comment pep:novel chromosome:BROADO5:Un:28012605:28036992:1 gene:ENSMODG00000016546 transcript:ENSMODT00000021020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQRIPVFPGGAPLLPPVVSVTIPVSSPLPPASFGLVMDPSKKIASSMLEAFDSPASSLD
PLDPLDLLPYTDSHLEGLDGFGPVRGSLDTLDSFTLEEPTSQDLRPPSSNAKPLPAQEPA
MPNTALLVKNPLASTHFFKQACHLCYPKTGPKAGDYTYREDLEHKCKRDILLGRIRNSED
KTWKRIRPRPTKTSFIGSYYLCKDMLNKQDCKYGDNCTFAYHQEEIDVWTEERKGTLNRD
LLFDPLGGVRRGSLTIAKLLKEHQGIFTFLCEICFDSKPRIISKGTKDSPAVCSNLAAKH
SFHDNKCLVHIVRSTALKYSKIRQFQEHFQFDVCRHEVRYGCLREDSCHFAHSFIELKIW
LLQQYSGMTHEDIVQESKKCWQQMEAHASKAANSLANSRGPPASAFDLQMKFVCGQCWRN
GQVVEPDKDLKYCSAKARHCWTKERRVLLVMSKVKRKWVSVRPLPSIRNFPQQYDLCIHA
QNGRKCQYVGNCSFAHSPEERDMWTFMKDNKSECVLASWLEKARGKAGPVPGRAHRVPVP
QMGFHCWLCGKNSNSKKQWQQHIQSEKHKEKVFTSESDSTCWTFRFPMGEFRLCERFQKK
KACPDGDKCRCAHGQEELTEWLDRREVLKQKLAKARKDMLLCPMDDDFGKYNFLLQDSDL
GRLSPSPRGPPSVLTGDPGR
Download sequence
Identical sequences H9H6Y7
ENSMODP00000020653 ENSMODP00000020653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]