SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020814 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020814
Domain Number 1 Region: 756-983
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-59
Family DBL homology domain (DH-domain) 0.00000000158
Further Details:      
 
Domain Number 2 Region: 363-539
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.36e-53
Family Regulator of G-protein signaling, RGS 0.000000103
Further Details:      
 
Domain Number 3 Region: 987-1121
Classification Level Classification E-value
Superfamily PH domain-like 6.01e-41
Family Pleckstrin-homology domain (PH domain) 0.000000431
Further Details:      
 
Domain Number 4 Region: 42-132
Classification Level Classification E-value
Superfamily PDZ domain-like 9.6e-21
Family PDZ domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020814
Domain Number - Region: 160-170
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00262
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020814   Gene: ENSMODG00000016676   Transcript: ENSMODT00000021181
Sequence length 1563
Comment pep:known_by_projection chromosome:BROADO5:2:192098116:192261964:-1 gene:ENSMODG00000016676 transcript:ENSMODT00000021181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQTIDRTTNKKQPQMSRLSSLSSLSDSAPEQKTPDHQGQPSDSCETTGLVQRCVI
IQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLI
KSGAYVALTLLGSSPSSVGVSGLQQDLGSLGTSRAIPVIPPPPPPPPLPPLQHITGPKPL
QDPEVQKHATQILQNMLRQEEKELQHFREVYSRNPASLLEEQIEGARRRVTQLQRKIQQG
SGGSVDILQMSDTNPANLKSSEGRHSLDSQDGDSGLDSGTERFPSLSESLLNRNSILSDP
GLDSPRTSPVIMAKVAQHHRRQGSDTTVLPTTEQGLEHSPKPLIIGPEEDYDPGYFNNES
DTLFQNLEKLKYRPAHLGVFLRYIFSQADPNPLLFYLCAEVYLQTYPKDSRGLGKTIWAI
FLEKNSPLRVKIPEALQAEIDLHLRNNEDIRSALSEAQEAIKPEIQEQIQDYRTKRTMGL
GSLYGENDLLDLDGDPQRERQVAEKQLAALGDILSKYEEVRSISMDFALNTYMSHAGIRF
REARPSTAEKSQTIPDKDKWLPFFPKTKKSSNAKKEKDALEDKKRNPILKYIGKPKSSSQ
NIKPGNVRNIIQHFENNQQYDSPEPGMQRLSTGSFPEDLLESESSRSEIRLGRSESLKGR
EEMKKSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRR
SIESPSLGYCTDALLPHLLEDDLGQLSDLEPEPDTQNWQHTVGKDVVAGLSQREIDRQEV
INELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMKK
LREEGPVIKEISDLMLARFDGAAREELQQVAAQFCSSQSIALELIKTKQRKESRFQLFMQ
EAESNPQCRRLQLKDLIVSEMQRLTKYPLLLENIIKYTDGGSSEYQKLCRARDQCREILK
YVNEVVKQTENRQRLESYQKRLDTTSLERASNPLAAEFKSLDLTTRRMIHEGPLAWRISK
DKTVDLHVLLLEDLLVLLQKQDEKLLLKCHSKTSLGSSDNKQTFSPVLKLNAVLIRSVAT
DKRAFFIICTSELGPPQIYELVALTSLDKNMWMELLEGAVQNATRNPSIVPDPAHLTQPA
PQQPSQHSSTPTSMGLSDSEASQGNDCHPEVELLPRGDGAQQWVNGKHQALSEEPKQEGS
EEELVASKSMSSLGGGGLGIRTRSTIHLPLPGPFFMEGLADSALEDVETLRHLILWSLLP
IHTIESRATVEPEDDLTPTPSVIGITSHPWDPGSPGQLPVGMEGNDLAPFGQMTSRMELE
MGELDDAALSSLEHLPPRARNSGIWEPPELDKDITEEPPTTEAVEGYKVVRKAEVAGSNA
VPALPECGKSETEPPEAGGGPNAAGNCFYVSMPTGPPESSTDPSDIARSSSQQDVPHSSP
TEPEHQGGGGNERRAPSLALRDVGMIFRTIEQLTLKLNRLKDMETAHRELLKSLGAESSG
GTTPVGGLSAEAAKWTESPPLPPAKESISSYSKDSHERGPGPAADPDSLLEDSPADTAIS
LGL
Download sequence
Identical sequences F7E6J3
ENSMODP00000020814 ENSMODP00000020814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]