SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020914 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020914
Domain Number 1 Region: 3-98
Classification Level Classification E-value
Superfamily POZ domain 9.81e-23
Family BTB/POZ domain 0.0078
Further Details:      
 
Domain Number 2 Region: 360-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000092
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 252-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000173
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 4 Region: 444-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000486
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020914   Gene: ENSMODG00000016757   Transcript: ENSMODT00000021283
Sequence length 514
Comment pep:known_by_projection chromosome:BROADO5:2:431136009:431144960:-1 gene:ENSMODG00000016757 transcript:ENSMODT00000021283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLANHGLILLQQLNAQREFGFLCDCTVAIGDVYFKAHKSVLASFSNYFKMLFVHQTSEC
VRLKPTDIQPDIFSYLLHLMYTGKMAPQLIDPVRLEQGIKFLHAYPLIQEASLASQGAFS
HPDQVFPLASSLYGIQIADHQVRQANKITSATDKLGREPRTQTSRISQEQISEGSQLSQL
NSNLTQVSRTNMTPSDPLQSSLSPELVSTPVPPPPPGEETNMEASSSDEQPASLTIAHVK
PSIMKRNGSFPKYYACHLCGRRFTLRNSLREHLQIHTGVPFTSNQPGESSVSLSLCSNAV
DLGKDAMEVPEAGMISDSELQHISDSPIIDGQQQSETPPPSDIADIDNLEQADQEREVKR
RKYECTICGRKFIQKSHWREHMYIHTGKPFKCSTCDKSFCRANQAARHVCLNQSIDTYTM
VDKQTLELCTFEEGSQMDNMLVHTNKPYKCNLCDKTFSTPNEVVKHSCQNQNSDVFALDE
GRSILLGSGDSEVTEPDHSVLASIKKEQETVLLD
Download sequence
Identical sequences F6YKZ5
13616.ENSMODP00000020914 XP_007484799.1.35504 XP_007484800.1.35504 XP_016284436.1.35504 ENSMODP00000020914 ENSMODP00000020914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]