SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020982 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020982
Domain Number 1 Region: 149-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.45e-27
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 93-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.1e-26
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 3 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 5 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 7 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 401-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.46e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 55-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 10 Region: 308-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000524
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 11 Region: 11-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000179
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020982   Gene: ENSMODG00000016814   Transcript: ENSMODT00000021352
Sequence length 627
Comment pep:novel chromosome:BROADO5:1:739842306:739886863:-1 gene:ENSMODG00000016814 transcript:ENSMODT00000021352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHEYSQYGRKYNLKSTLITKQKVPIEKTLHKCDIHGKNLKPNSDIIKHQENTEKKTYKCN
DCEKVYNDLSTLTQHYILHTGERPYKCNDCGKAFSRSSSLNKHQRIHTGEKPYECNECGK
AFLQSTHFIQHQRIHTGEKPYGCNECGKSFSQSSYLNQHQRIHTGEKPYECNDCGKTFSR
SAHLTQHQRIHTGEKPFKCDECGRAFSRNSSLFEHQKIHTGDKPYECNECGKAFSQSTLL
TQHQRIHTDDKSYKCSECGKAFSRSSCLSKHQRIHTGEKPYNCNECGKAFSQSSCLSKHQ
RIHTGEKPYGCDICGKAFSQSTHLTEHQLIHTGEKPYECIKCGKMFSRKSSLLEHQFIHT
GEKPYECVKCGKTFSRKSSLIEHQFIHTGEKPYKCNECEKTFSQRSCLSKHQRKNPFHIN
EKPYKCSECGKAFSYASSLTKHHRIHTGEKPYVCKECGKAFSESSNLIQHRKIHTVEKLY
KCKECGKAFNKNSSLTQHLRIHTGERPYKCKECGKAFTFNKNSALTQHLRIHSGEKPFKC
KECGKAFSENSSLTQHLRIHTGEKPYECKECGKAFNRSSSLNKHLKNHSGKKPYNVMNVE
KPLVRTHTLLNTKKFMWNINPVNLMNV
Download sequence
Identical sequences F7FV92
13616.ENSMODP00000020982 ENSMODP00000020982 ENSMODP00000020982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]