SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021010 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021010
Domain Number 1 Region: 694-804
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 8.89e-29
Family Elongation factor TFIIS domain 2 0.0047
Further Details:      
 
Domain Number 2 Region: 289-352
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.13e-16
Family PHD domain 0.0000225
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021010
Domain Number - Region: 1307-1317
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000222
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021010   Gene: ENSMODG00000016832   Transcript: ENSMODT00000021380
Sequence length 2332
Comment pep:known_by_projection chromosome:BROADO5:1:475636399:475676927:1 gene:ENSMODG00000016832 transcript:ENSMODT00000021380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHAVNPESSVAFKSESSLDNMESNSQGLDDKGDPSNDEAPKAIKPTSKEFRKTWGFRRT
TIAKREGAGDAEIDSLDQQPQQQQQSLSLRRSGRQPKRTERVEEFLTTVRRRGRKNVPVT
LEDSSEPASCPVTDVETASEGSVESTPETKTGQKSDSRNVKSQSTIVAKGTKEEEEEEDD
TSDSDSDGLTLKELQNRLRRKREQEPSELTLKGIQNRLRKKRREEDPTETVDVEAGNTVE
TEVPSKQEPETVDQVPMPQESKEEQDIKLEGKVPQGIKDEEPEELVKRKPECEVYDPNAL
YCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQDETA
SESDQQEAKFRHENADGTELTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIE
TPGASKCIGPGCSSVAQPDSVYCSNDCILKHAAATMKFLSAGKEPKPKVKEKPKLKPEKC
NLPKSGVQAGIKISSVQKRPAPDKKENIAKKTVVTTPRNEGLVKETTSESSTPSWASDHN
YNAVKPEKTAAISSSLLYKSMKEEKRMEDKMATPLPVTKKVIPSTSTSTSVVGKQTSSLP
RNLVSKKAPSFINASVTKQAVKNSPGGFKGVIPKKSWLSGSPSGNVSNTKQSGLASASVA
SASKKLNVSSTLAGGPRKPVTPTANPASSSTTGKSGASPSQSQPNSQIRQNIRRSLKEIL
WKRVNDSDDLIMTENEVGKIALHIEKEMFNLFQVTDNRYKSKYRSIMFNLKDPKNQGLFH
RVLREEISLAKLVRMKPEELVSKELSMWKEKPTKSMIESRNKLHSESKKSVMKQEAIPDM
EDSPPVSDSDEQELARAVPEKSSAPLLDVFSSMLKDTTSQHRAHLFDLNCKICTGQVPSS
EDEPAPKKPKLSASVKKVESKSKFDSSGSGLVTNAVDELISEATVENTLEPEVESISQLN
LERNYFPVPLGHGNVEPSSMEENSLYPISSSAGVVTTVTVSGRDPRTALSSSATINTSAS
RPGSGPLTDKLLTGETKQEVLKPVLTPTAVPKSILAKPSSLPDPRYLPVPPSPNINIPES
RSPQEGDTSLFLSRLSTIWKGFINMQSVAKFVTKAYPVSGCFDYLSEDLPDTIHIGGRIS
PKTVWDYVGKLKSSISKELCLIRFHPATEEEEVAYISLYSYFSSRGRFGVVANNNRHIKD
LYLIPLSAKDPIPSKLLPFEGPGLESPRPNIILGLVICQKVKRPSNAGELDKMEEKRSKI
QTQEEIEVSVYPKGVTSSQSEKKQSKYQLYSADTSVSTTPPGSPPPPPPPPPPPPPPLPD
PPASSSVLKILSSLKTGTTNTTTPSVSSATITTTTSSPGNSSSSKTASPLEHILQTLFGK
KKSFDSATKDSELTSTLNQESKMDEGVPATPLLDPIVQQFGKMSKDKSLEEEEDDRPYDP
EEEYDPEKAFETQITESEKRYDIEKPSELSEKEDVAYDPEDETILEEAKVTIDDLPNKMC
TDNKNSTERPSEYVTDISAPSSLVEQQKMLEELNKQIEEQKRQLEEQEEALRQQRAAVGV
SMAHFSVSDALMSPPPKSSLTKTEIFQQEQQNADKSDSSSISRNQSSDLRQSRDPRQARR
IATENNENENLLKPLSSSSHSGTSMREPPAAVNLGQLPTPSQEEKELNNDKWVTGEKATV
LDQDGQNDKKNAHPSISEVSSKPLRKVLLPTPPNTSFQPNFPVQNDGQTFNSPAGASGPF
SNTVFSSQEKSLGSSQYEDRRNPQFVEKNDSSAVQDEGERGSQSKLDDNRVLSFPLSGLK
GGPPQSQFQGQNEPASRNYGATSGPHGPNFPGPRGPTPQFSEENNSGTDGQRGPSSARFG
GQKAPIPSLFSGQHGPPPFGDSRGPSPSYLGGPRGVAPSQFEDRRDPHGEKREFQDSQYS
DMTSPPQFEGPEQSQFMGNRGPAPFPFGGQRRPLLSQFKGPRGGPPPNQFGGQRGPPPGH
FVGPRGPHPNQFFEGPRGPHPNQFEGPRGPAPNFMPGPRVIQPQQFEEQRVNSPPRFANQ
RGPTPLQFGPRGAAPFSEKNEQPPSRFHFQGQSPQGIKPAPRPLLELPSHPPQHRKERWE
EAGPSAPLPTNVSGQASESESQWPSSDFRDGKSHEYRNQAFEGRQRERFEGGTKEKSSDE
PETQLSENRQGRGFEDRRRDRDHGKPWERDRGRNWSRDRERDWDRNRDWERHREKDSNRD
WDKNKERNPNRDKERESERNKEWERNRERGRNRDRDRERDRDRRRDRDRSRSRDRDRDRT
RERDRERDRDREKERERDRGKDRKDRSKSKESSRDSKPEEQKEVQKPAETEG
Download sequence
Identical sequences F6R280
ENSMODP00000021010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]