SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021020 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000021020
Domain Number - Region: 231-313
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00863
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021020   Gene: ENSMODG00000016842   Transcript: ENSMODT00000021390
Sequence length 510
Comment pep:known_by_projection chromosome:BROADO5:1:474777907:474785470:1 gene:ENSMODG00000016842 transcript:ENSMODT00000021390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPYLSSYYPPSIGFPYSLSEAPWSTGGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGG
LGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSSYSYPPSSLGGTIVDGQTGFH
NDTLNKAPGMNSIEQGMVGLKIGGDVTTSAVKTVGSVNSAVMTGALSGNGGSNVNLPVSK
PTSWAAIASKPAKPQPKMKTKSGPIIGGALPPPPIKHNMDIGTWDNKGPVNKAPAPQQIP
SPQSLPQSQQQIVQPIPTQPPPLAQTQYQNPQQPPPNRWVAPRNRNAAFGQSGGTSSDSN
STGNAQTNSVPSGESHPVLEKLKAAHSYNPKEFDWNLKNGRVFIIKSYSEDDIHRSIKYS
IWCSTEHGNKRLDSAFRSLNSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDK
WKGKFDVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISTYKHT
TSIFDDFSHYEKRQEEEEVVRKERQNRNKQ
Download sequence
Identical sequences F6QHV0
ENSMODP00000021020 ENSMODP00000021020 XP_007475637.1.35504 XP_016283496.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]