SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021073 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021073
Domain Number 1 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 335-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 222-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 278-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-21
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 5 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 184-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 437-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000367
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021073   Gene: ENSMODG00000016885   Transcript: ENSMODT00000021444
Sequence length 468
Comment pep:novel chromosome:BROADO5:7:4960029:4961593:1 gene:ENSMODG00000016885 transcript:ENSMODT00000021444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITLKDVTVDFTQEEWCLLDPSQKELYREVMLENAWNLYSLGLSVPREIFVSCFQQGEALW
LIEQKGLRGSYPEFETNIEVEISTKLSLFSDCEFGKTAKIFNQYSALNHYTKLTSGNDCC
QDSEYSKCFPEEIQIVQLPEKPLEMPMYQGIQGEMTIGWSLNLIRHSKNKSWFTSNNSLW
GKKKTFECRQCGKAFTRRSSVAVHQRIHTGEKPYDCKQCGKAFTQRSHLARHQTVHTGEK
PYECKQCGKAFTQCGSLAKHQRIHIGEKPSECKQCGKTFTQRGSFTSHQRIHTGERLYEC
KQCEKAFRLKDSLAAHQRIHTREKPYECKQCEKLFRGRSSLAVQQRIHTGEKPYECKECG
RAFTWRDSLAAHQRIHIGEKPYECKQCGKAFTQRCSLGAHQRIHTGEKPYECKHCGKTFT
ERGSLAAHQRIHTGEKPYKCTQCGKAFTWRSDFAKHQSIHIGEKIYEC
Download sequence
Identical sequences F6XJF1
13616.ENSMODP00000021073 ENSMODP00000021073 ENSMODP00000021073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]