SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021083 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021083
Domain Number 1 Region: 219-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 261-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 357-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000665
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 292-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000466
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 186-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000131
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 6 Region: 1-44
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000641
Family KRAB domain (Kruppel-associated box) 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021083
Domain Number - Region: 135-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0065
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021083   Gene: ENSMODG00000016896   Transcript: ENSMODT00000021455
Sequence length 406
Comment pep:novel chromosome:BROADO5:7:5630555:5631896:1 gene:ENSMODG00000016896 transcript:ENSMODT00000021455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EWRQLINAQKSLYREVMLENYENFVSVAGFPSFKPELISQLECGKGPWMLVEEEMIQRFS
ERPRRLSLFSAFPWRIHQKKLTKGGPWDHEFGERNLIKGTQDKILSRTRGHKCNQFMKNF
NKNPVLDTPSNVSSEKNTRKQSCKKALSNPSDLNEVQRIATKEKPYTCIEFGRGHIQCHR
NPSLGKPYICRDCGKPFSPITYLIQHQGIHGGERPYNCTFTSSSSLILHHIIHRGEKPYE
CHEGRKLFSKRTGLFVHQRIHTGEKPYKCEICEKAFRQQGDLSQHQKIHNEEKPYKCRDY
GKAFTQREHLTEHRVHSGEKPYKCDCDKDFSNSSQVTLHYRIHTGEKPNKCNAFGQAFSH
PGSLSEHQKIHSVEKPYKCSECGKVFSPNLYLSCHQTVHTGEKVFS
Download sequence
Identical sequences F6XIH1
13616.ENSMODP00000021083 ENSMODP00000021083 ENSMODP00000021083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]