SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021134 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021134
Domain Number 1 Region: 545-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000566
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021134
Domain Number - Region: 775-826
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00409
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 732-759
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0106
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021134   Gene: ENSMODG00000016943   Transcript: ENSMODT00000021507
Sequence length 1121
Comment pep:novel chromosome:BROADO5:7:11231544:11333658:1 gene:ENSMODG00000016943 transcript:ENSMODT00000021507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEESDQEAERLGEELEAIVESPPGSVAFGTGVGGDGEGSCGSGSSSSSRISSRDYCRR
FCQVVEDYAGRWQVPLPQLQVLQTALCCFTTASVSFPTECEHVQYVLSSLALSFFELLLF
FGKDEFYEEPLKDILGSIQECQNHLSRYGNVNLELVTRIIRDGGPWEDPVLQAVLKAKPA
SQDIVNKYLSSENPLFFELRARYLIACERIPEAMALIKCCINHPDISKDLYFHQAFFTCL
YMSPLEDQLFQEHVLRTDCKNGIDIICNTEKEGKTTLALQLCESFLIPQLQNGDMYCIWD
LIFIWSKLQLKSNPSKQVFVDQCYQLLRTATNVRVIFPFMKIIKDEVEVEGLQICVEICG
CALQLDLQDDPNTKCLIYKAIAHFLPNDLEILRICALSVFFLERSLESYYTVERLYKHPD
EEYNECTSSVQNRVRFELLPILKKGLFFDPEFWNFIMIKQNCAALLRDKLTGGFLNENTL
ENAISHPEKMKETQVLDEELVFLMDLSNGEYDPEDVPGAQSKGHGNTKKNLTTFNASKID
RNVPRHKCVLCNREFLGGHIVRHAQAHQKKGSFSCVICGRKFRNRGLMLKHLKNHVKKIQ
RQHFAVVQQEDQGIPITEQINCFGASISFENGNSDINEIETTIAYNIENKEEGAFEQIAE
VTKNCICEPHDVIKNGSPDSSLIDTLEPLTTESLPRCIEDDDDFNRETPILHKINGTVCP
QKDLDSMDQQENFKCPANGCVRIFKKIRFLNKHARKAHPTDLKVQQHIMKWNKGKCRFCQ
RKFEDSQHFIDHLKRHIYPNVYFCLHFTCNQRFKLLTELTEHTKSHSVFQAQCNFPECHE
LFEELPLLYEHEAQHYLNATPEPSAETSRNVLDTLTKLQCESQEKDLSGSEKETVDLPVP
TWKSRKDSTEPKTYIQSVEKKTNSVVQNGNDHSSDVTASAKSFIDQKMPVVEPNSEKSSV
ISDQLLVNGHSELEQTSLISADAALKSETSGTRTENGSISQNVEVVPQEPSPLVVVSQSP
SKPNPPTENTSYGLILTKPYVRPLPPSYLDERYISMPKRRKTLTDKADAHSDQDSVSSTS
SERFRCGNCLTIYCNSEALEAHLAQKKCQTLFGFDSDDESA
Download sequence
Identical sequences F6VMF5
XP_007500816.1.35504 ENSMODP00000021134 ENSMODP00000021134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]