SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021165 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021165
Domain Number 1 Region: 403-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.98e-16
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 379-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000879
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021165   Gene: ENSMODG00000016968   Transcript: ENSMODT00000021538
Sequence length 485
Comment pep:known_by_projection chromosome:BROADO5:1:740772506:740774706:1 gene:ENSMODG00000016968 transcript:ENSMODT00000021538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNMSEFCPEALFAKYPEGCIETSQETLRPGRDPSLAGFPGGDFLSSALSGACDTSDYFF
LEGPSSSPQPGLSYTGSFFIQAIPEHPHDQEALFNLMSGILGLAPFPGPDGAVPRAPLDT
LYATSPDTSLPGPLDLFSADLGSSFPETPWETSPTAGTSPQCLYEPQPSPPDVKPSLRAP
PVSPDLDASPAFKAPYGPWDLLSAGAPSYLPQGSYQPSPEGGFPPLGSKIEDLLQISCPA
DLPGPANRIYTGTYDAFSLSSSSQLPSGDFGEGGESLQPGLSLSPPAEGGGGGELLARAQ
PSPLSHTLPGPASDFSAVPPTTTDFPRAAQLPPPTAAPPQSQPPQPQSQPAQAEPRRKGR
RGGKCSPRCFCPRPHAKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSR
SDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRHGKVHLKQKARAEERLKGLGFYALGL
SFAAL
Download sequence
Identical sequences F6V4R7
ENSMODP00000021165 13616.ENSMODP00000021165 XP_001374709.1.35504 ENSMODP00000021165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]