SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021206 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021206
Domain Number 1 Region: 324-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.19e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 267-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 379-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 155-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 99-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 6 Region: 212-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.3e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 7 Region: 426-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000428
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 46-100
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000172
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021206   Gene: ENSMODG00000016999   Transcript: ENSMODT00000021579
Sequence length 457
Comment pep:novel chromosome:BROADO5:Un:60643705:60645075:-1 gene:ENSMODG00000016999 transcript:ENSMODT00000021579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEGEIRPEMKANSTEGSYPVEEMDLQRFMHKRPDNFASREFCVAHQNSSHIEHQRMQPEE
KSSENNQCRKNFIHRSSVVGHDRIHTSKESYDCKQYGNTFNESSSFAIHQRLHTGEKLYE
CKQCGKTFNQRSHLAVHQRMHTLEKPYECKQCGKTFKQMSYVAVHQRMHTGEKPYECMEC
GKTFNTRSHLAVHHRIHTGEKPYECKQCGKKFKVRSHLVQHQRLHTGEKPYECKQCQKTF
TSALGLATHLRIHSGEKPFECKQCGRTFTCNSNLSRHQRIHTGEKPYECKHCGKTFTCTT
SLIVHQRMHTGEKPYECKQCGKKFTSTSSLTVHQRIHTGEKPYECNQCGKAFTRISSLSL
HQRVHTGERPYECNQCGKTFNQMSHLAVHQRLHTGERPYECKECGKTFNQRSHLVIHQRM
NSGEKPYECNQCGMTFMCSSSLDVHQRIHTGMKSYEC
Download sequence
Identical sequences H9H726
13616.ENSMODP00000021206 ENSMODP00000021206 ENSMODP00000021206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]