SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021235 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021235
Domain Number 1 Region: 9-126
Classification Level Classification E-value
Superfamily POZ domain 1.3e-31
Family BTB/POZ domain 0.00042
Further Details:      
 
Domain Number 2 Region: 429-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021235   Gene: ENSMODG00000017020   Transcript: ENSMODT00000021608
Sequence length 595
Comment pep:known_by_projection chromosome:BROADO5:1:473097777:473181705:1 gene:ENSMODG00000017020 transcript:ENSMODT00000021608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNRKEDMEIASHYRHLLRELNEQRQHGILCDVCIIVEGKIFKAHKNVLLGSSRYFKTLY
CQVQKTSDQATVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASYLQMTDIVQA
CHNFIKAALDISIKSDASDELADYEIGAPSSSSTDALISAVVAGRSISPWLARRTSPANS
SGDSAIASCHEGGSSYGKEDQEPKTDNHEDISSQSLWTSDMGYGSLRIKEEQISPSHYSG
NELRTVKDSSVQNTFSEQSIGDGWQPTGRRKNRKNKETVRHITQQVEDDSRASSPMPSFL
SASGWPYNNRDPNADLTVTEPSSSDSRGERTDLYANTDEALLGGEASYLSQPLTPEKEDA
LHQATAVANLRAALMSKNSLLSLKADMLGDDSSLLFEYLPKGTHSLSLNEFTVIRKKFKC
PYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVHSKDKKYVCKVCN
RVFMSAASVGIKHGSRRHGVCTDCSGRGIAGHLDQNGGEGSPDEMYPGEGQYMEDPDDIK
VEGDEELGDDDEIKWKDDVGISQDDVILEDDKEDVDSPQEHENSGEHDKDFTWIS
Download sequence
Identical sequences F6Y0Y3
13616.ENSMODP00000021235 XP_007475585.1.35504 ENSMODP00000021235 ENSMODP00000021235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]