SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021334 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021334
Domain Number 1 Region: 275-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-20
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 2 Region: 219-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 321-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000521
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021334
Domain Number - Region: 186-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00126
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021334   Gene: ENSMODG00000017096   Transcript: ENSMODT00000021708
Sequence length 404
Comment pep:known_by_projection chromosome:BROADO5:4:430369040:430376142:-1 gene:ENSMODG00000017096 transcript:ENSMODT00000021708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMAEPRFNNPYFWPPPPTMPSQLDNLVLINKIKEQLMAEKIRPPHLPPTSVSSQQPLLVP
PSPAESSQSIMSLPKLQQVPGLHPQAVPQPDVALHARPATSTVTGLGLSSRAPAVSTSES
STGTGTSTPSTPTSTSQSRLIASSPTLISGITSPPILDSIKTIQGHSLLGAPKTERGRKK
IKAENPSGPPVLVVPYPILASGETAKEGKTYRCKVCPLTFFTKSEMQIHSKSHTEAKPHK
CPHCSKSFANASYLAQHLRIHLGVKPYHCSYCEKSFRQLSHLQQHTRIHTGDRPYKCPHP
GCEKAFTQLSNLQSHQRQHNKDKPYKCPNCYRAYTDSASLQIHLSAHAIKHAKAYCCSMC
GRAYTSETYLMKHMSKHTVVEHLVTHHSPQRTESPGIPVRISLI
Download sequence
Identical sequences F6V344
13616.ENSMODP00000021334 ENSMODP00000021334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]